| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Interleukin-6 |
|---|
| Ligand | BDBM140018 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Fluorescence Polarization Ligand Binding Assay |
|---|
| IC50 | 4.3±n/a nM |
|---|
| Citation |  Rucker, PV; Snyder, JS Tricyclic compounds, compositions, and methods US Patent US8901310 Publication Date 12/2/2014 |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Interleukin-6 |
|---|
| Name: | Interleukin-6 |
|---|
| Synonyms: | B-cell stimulatory factor 2 | BSF-2 | CDF | CTL differentiation factor | Hybridoma growth factor | IFN-beta-2 | IFNB2 | IL-6 | IL6 | IL6_HUMAN | Interferon beta-2 |
|---|
| Type: | n/a |
|---|
| Mol. Mass.: | 23717.96 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P05231 |
|---|
| Residue: | 212 |
|---|
| Sequence: | MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYI
LDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLL
EFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQ
AQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
|
|
|
|---|
| BDBM140018 |
|---|
| n/a |
|---|
| Name | BDBM140018 |
|---|
| Synonyms: | US8901310, Comparator H |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C29H30F2N2O2 |
|---|
| Mol. Mass. | 476.5575 |
|---|
| SMILES | Cc1ncccc1NC(=O)c1ccc2c(CC[C@@H]3C[C@](O)(CC[C@@]23Cc2ccccc2)C(F)F)c1 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
