Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetTyrosine-protein kinase SYK
LigandBDBM140340
Substrate/Competitorn/a
Meas. Tech.Kinase Assay
pH7.5±n/a
Temperature193.15±n/a K
IC50 1±n/a nM
Citation Hoffmann MBischoff DDahmann GKlicic JSchaenzle GWollin SLConvers-Reignier SGEast SPMarlin FJMcCarthy CScott J Substituted quinolines and their use as medicaments US Patent  US8912173 Publication Date 12/16/2014
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Tyrosine-protein kinase SYK
Name:Tyrosine-protein kinase SYK
Synonyms:Lysyl-tRNA synthetase | SYK | Spleen Tyrosine Kinase | Spleen tyrosine kinase (SYK) | Tyrosine-protein kinase SYK (Syk)
Type:Enzyme
Mol. Mass.:72079.99
Organism:Homo sapiens (Human)
Description:P43405
Residue:635
Sequence:
MASSGMADSANHLPFFFGNITREEAEDYLVQGGMSDGLYLLRQSRNYLGGFALSVAHGRK
AHHYTIERELNGTYAIAGGRTHASPADLCHYHSQESDGLVCLLKKPFNRPQGVQPKTGPF
EDLKENLIREYVKQTWNLQGQALEQAIISQKPQLEKLIATTAHEKMPWFHGKISREESEQ
IVLIGSKTNGKFLIRARDNNGSYALCLLHEGKVLHYRIDKDKTGKLSIPEGKKFDTLWQL
VEHYSYKADGLLRVLTVPCQKIGTQGNVNFGGRPQLPGSHPATWSAGGIISRIKSYSFPK
PGHRKSSPAQGNRQESTVSFNPYEPELAPWAADKGPQREALPMDTEVYESPYADPEEIRP
KEVYLDRKLLTLEDKELGSGNFGTVKKGYYQMKKVVKTVAVKILKNEANDPALKDELLAE
ANVMQQLDNPYIVRMIGICEAESWMLVMEMAELGPLNKYLQQNRHVKDKNIIELVHQVSM
GMKYLEESNFVHRDLAARNVLLVTQHYAKISDFGLSKALRADENYYKAQTHGKWPVKWYA
PECINYYKFSSKSDVWSFGVLMWEAFSYGQKPYRGMKGSEVTAMLEKGERMGCPAGCPRE
MYDLMNLCWTYDVENRPGFAAVELRLRNYYYDVVN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM140340
n/a
NameBDBM140340
Synonyms:US8912173, 66
TypeSmall organic molecule
Emp. Form.C23H25N3O3
Mol. Mass.391.4629
SMILESCC(C)Oc1ccc(cn1)-c1cc(O[C@H](C)[C@H]2CNC(=O)C2)c2cccnc2c1 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: