Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Targetp38 delta/gamma
LigandBDBM142605
Substrate/Competitorn/a
Meas. Tech.Fluorescence Resonance Energy Transfer (FRET) Assay
IC50 100±n/a nM
Citation Murray PJOnions STWilliams JGJoly K Respiratory formulations and compounds for use therein US Patent  US8933228 Publication Date 1/13/2015
More Info.:Get all data from this article,  Assay Method
 
p38 delta/gamma
Name:p38 delta/gamma
Synonyms:MAP kinase p38 gamma | Mitogen-activated protein kinase 12 (MAPK12 p38 gamma) | Mitogen-activated protein kinase 12 (p38 gamma) | Mitogen-activated protein kinase p38 gamma (p38 MAPKγ)
Type:Protein
Mol. Mass.:41938.69
Organism:Homo sapiens (Human)
Description:P53778
Residue:367
Sequence:
MSSPPPARSGFYRQEVTKTAWEVRAVYRDLQPVGSGAYGAVCSAVDGRTGAKVAIKKLYR
PFQSELFAKRAYRELRLLKHMRHENVIGLLDVFTPDETLDDFTDFYLVMPFMGTDLGKLM
KHEKLGEDRIQFLVYQMLKGLRYIHAAGIIHRDLKPGNLAVNEDCELKILDFGLARQADS
EMTGYVVTRWYRAPEVILNWMRYTQTVDIWSVGCIMAEMITGKTLFKGSDHLDQLKEIMK
VTGTPPAEFVQRLQSDEAKNYMKGLPELEKKDFASILTNASPLAVNLLEKMLVLDAEQRV
TAGEALAHPYFESLHDTEDEPQVQKYDDSFDDVDRTLDEWKRVTYKEVLSFKPPRQLGAR
VSKETPL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM142605
n/a
NameBDBM142605
Synonyms:US8933228, 7
TypeSmall organic molecule
Emp. Form.C32H29N7O3
Mol. Mass.559.6178
SMILESCc1nc2c(Oc3ccc(NC(=O)Nc4cc(nn4-c4ccccc4)C(C)(C)C)c4ccccc34)ccnc2[nH]c1=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: