Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSomatostatin receptor type 1
LigandBDBM144759
Substrate/Competitorn/a
Meas. Tech.Radioligand Binding Assay
pH7.6±n/a
Temperature298.15±n/a K
Ki 91.4±n/a nM
Commentsextracted
Citation Dong ZXShen YKim SH Somatostatin-dopamine chimeric analogs US Patent  US8952128 Publication Date 2/10/2015
More Info.:Get all data from this article,  Assay Method
 
Somatostatin receptor type 1
Name:Somatostatin receptor type 1
Synonyms:SOMATOSTATIN SST1 | SRIF-2 | SS-1-R | SS1-R | SS1R | SSTR1 | Somatostatin receptor type 1 (SSTR1)
Type:Enzyme
Mol. Mass.:42692.81
Organism:Homo sapiens (Human)
Description:P30872
Residue:391
Sequence:
MFPNGTASSPSSSPSPSPGSCGEGGGSRGPGAGAADGMEEPGRNASQNGTLSEGQGSAIL
ISFIYSVVCLVGLCGNSMVIYVILRYAKMKTATNIYILNLAIADELLMLSVPFLVTSTLL
RHWPFGALLCRLVLSVDAVNMFTSIYCLTVLSVDRYVAVVHPIKAARYRRPTVAKVVNLG
VWVLSLLVILPIVVFSRTAANSDGTVACNMLMPEPAQRWLVGFVLYTFLMGFLLPVGAIC
LCYVLIIAKMRMVALKAGWQQRKRSERKITLMVMMVVMVFVICWMPFYVVQLVNVFAEQD
DATVSQLSVILGYANSCANPILYGFLSDNFKRSFQRILCLSWMDNAAEEPVDYYATALKS
RAYSVEDFQPENLESGGVFRNGTCTSRITTL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM144759
n/a
NameBDBM144759
Synonyms:US8952128, 17
TypeSmall organic molecule
Emp. Form.C101H133N21O13S2
Mol. Mass.1913.4
SMILESC[C@@H](O)[C@@H]1NC(=O)[C@H](CCCCN)NC(=O)[C@@H](Cc2c[nH]c3ccccc23)NC(=O)[C@H](Cc2ccncc2)NC(=O)[C@H](Cc2ccccc2)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@@H](CCCCNC(=O)[C@H](Cc2ccccc2)NC1=O)NC[C@H](CCCCNC(=O)CS(=O)C[C@@H]1C[C@H]2[C@@H](Cc3c[nH]c4cccc2c34)N(C)C1)NC(=O)CS(=O)C[C@@H]1C[C@H]2[C@@H](Cc3c[nH]c4cccc2c34)N(C)C1 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: