Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSomatostatin receptor type 5
LigandBDBM144752
Substrate/Competitorn/a
Meas. Tech.Radioligand Binding Assay
pH7.6±n/a
Temperature298.15±n/a K
Ki 0.09±n/a nM
Commentsextracted
Citation Dong ZXShen YKim SH Somatostatin-dopamine chimeric analogs US Patent  US8952128 Publication Date 2/10/2015
More Info.:Get all data from this article,  Assay Method
 
Somatostatin receptor type 5
Name:Somatostatin receptor type 5
Synonyms:SOMATOSTATIN SST5 | SS-5-R | SS5-R | SS5R | Somatostatin receptor type 5 (SSTR5)
Type:Enzyme
Mol. Mass.:39218.02
Organism:Homo sapiens (Human)
Description:P35346
Residue:364
Sequence:
MEPLFPASTPSWNASSPGAASGGGDNRTLVGPAPSAGARAVLVPVLYLLVCAAGLGGNTL
VIYVVLRFAKMKTVTNIYILNLAVADVLYMLGLPFLATQNAASFWPFGPVLCRLVMTLDG
VNQFTSVFCLTVMSVDRYLAVVHPLSSARWRRPRVAKLASAAAWVLSLCMSLPLLVFADV
QEGGTCNASWPEPVGLWGAVFIIYTAVLGFFAPLLVICLCYLLIVVKVRAAGVRVGCVRR
RSERKVTRMVLVVVLVFAGCWLPFFTVNIVNLAVALPQEPASAGLYFFVVILSYANSCAN
PVLYGFLSDNFRQSFQKVLCLRKGSGAKDADATEPRPDRIRQQQEATPPAHRAAANGLMQ
TSKL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM144752
n/a
NameBDBM144752
Synonyms:US8952128, 11
TypeSmall organic molecule
Emp. Form.C77H101N17O11S
Mol. Mass.1472.798
SMILESC[C@@H](O)[C@@H]1NC(=O)[C@H](CCCCN)NC(=O)[C@@H](Cc2c[nH]c3ccccc23)NC(=O)[C@H](Cc2ccncc2)NC(=O)[C@H](Cc2ccccc2)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@@H](CCCCNC(=O)[C@H](Cc2ccc(O)cc2)NC1=O)NCC[S@](=O)C[C@@H]1C[C@H]2[C@@H](Cc3c[nH]c4cccc2c34)N(C)C1 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: