Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Target5-lipoxygenase-activating protein (FLAP)
LigandBDBM145785
Substrate/Competitorn/a
Meas. Tech.Homogeneous Time Resolved Fluorescence Assay
Ki 0.47±n/a nM
Citation Chai WDvorak CAEccles WEdwards JPGoldberg SDKrawczuk PJLebsack ADLiu JPippel DJSales ZSTanis VMTichenor MSWiener JJ 1,2,6-substituted benzimidazoles as FLAP modulators US Patent  US8952177 Publication Date 2/10/2015
More Info.:Get all data from this article,  Assay Method
 
5-lipoxygenase-activating protein (FLAP)
Name:5-lipoxygenase-activating protein (FLAP)
Synonyms:n/a
Type:Protein
Mol. Mass.:24212.61
Organism:Homo sapiens (Human)
Description:A0A087WW23
Residue:218
Sequence:
MLTFNHDAPWHTQKTLKTSEFGKSFGTLGHIGNISHQCWAGCAAGGRAVLSGEPEANMDQ
ETVGNVVLLAIVTLISVVQNGFFAHKVEHESRTQNGRSFQRTGTLAFERVYTANQNCVDA
YPTFLAVLWSAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIILFLF
LMSVAGIFNYYLIFFFGSDFENYIKTISTTISPLLLIP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM145785
n/a
NameBDBM145785
Synonyms:US8952177, 139 | US9089569, 139 | US9695149, 139
TypeSmall organic molecule
Emp. Form.C35H31F4N3O3
Mol. Mass.617.6326
SMILESCc1cnc(COc2ccc3nc([C@H]4CCCC[C@H]4C(O)=O)n(Cc4ccc(cc4)-c4ccc(cc4)C(F)(F)F)c3c2)c(F)c1 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: