| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Serine/threonine-protein kinase pim-1 |
|---|
| Ligand | BDBM149689 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Trans-Phosphorylation Assay |
|---|
| pH | 3±n/a |
|---|
| IC50 | 4±n/a nM |
|---|
| Comments | extracted |
|---|
| Citation |  Caldarelli, M; Angiolini, M; Beria, I; Brasca, MG; Casuscelli, F; D'Alessio, R; Lombardi Borgia, A Tricyclic pyrrolo derivatives, process for their preparation and their use as kinase inhibitors US Patent US8975267 Publication Date 3/10/2015 |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Serine/threonine-protein kinase pim-1 |
|---|
| Name: | Serine/threonine-protein kinase pim-1 |
|---|
| Synonyms: | PIM-1 Kinase | PIM1 | PIM1_HUMAN | Proto-oncogene serine/threonine-protein kinase Pim-1 | Serine/threonine-protein kinase (PIM1) | Serine/threonine-protein kinase PIM | Serine/threonine-protein kinase PIM1 | Serine/threonine-protein kinase pim-1 (PIM1) |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 35681.82 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P11309 |
|---|
| Residue: | 313 |
|---|
| Sequence: | MLLSKINSLAHLRAAPCNDLHATKLAPGKEKEPLESQYQVGPLLGSGGFGSVYSGIRVSD
NLPVAIKHVEKDRISDWGELPNGTRVPMEVVLLKKVSSGFSGVIRLLDWFERPDSFVLIL
ERPEPVQDLFDFITERGALQEELARSFFWQVLEAVRHCHNCGVLHRDIKDENILIDLNRG
ELKLIDFGSGALLKDTVYTDFDGTRVYSPPEWIRYHRYHGRSAAVWSLGILLYDMVCGDI
PFEHDEEIIRGQVFFRQRVSSECQHLIRWCLALRPSDRPTFEEIQNHPWMQDVLLPQETA
EIHLHSLSPGPSK
|
|
|
|---|
| BDBM149689 |
|---|
| n/a |
|---|
| Name | BDBM149689 |
|---|
| Synonyms: | US8975267, 30 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C16H18N4OS |
|---|
| Mol. Mass. | 314.405 |
|---|
| SMILES | CSc1ncc2ccc3c(C(N)=O)c(C)n(C(C)C)c3c2n1 |
|---|
| Structure | 
|
|---|
Search and Browse
