Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPeripheral-Type Benzodiazepine Receptor
LigandBDBM150167
Substrate/Competitorn/a
Meas. Tech.Competitive Binding Assay
Temperature303.15±n/a K
Ki 11.09±n/a nM
IC50 26.05±n/a nM
Commentsextracted
Citation Yang RLi YLi YZhao NYun LQin JFeng ZZhang Y 2-aryl imidazo[1,2-a]pyridine-3-acetamide derivatives, preparation methods and uses thereof US Patent  US8980887 Publication Date 3/17/2015
More Info.:Get all data from this article,  Assay Method
 
Peripheral-Type Benzodiazepine Receptor
Name:Benzodiazepine receptors; peripheral & central
Synonyms:Mitochondrial benzodiazepine receptor | PBR | PKBS | Peripheral benzodiazepine receptor (PBR)
Type:Mitochondrion membrane protein
Mol. Mass.:18945.84
Organism:Rattus norvegicus (rat)
Description:Competitive binding experiments were performed on rat kidney mitochondrial membranes.
Residue:169
Sequence:
MSQSWVPAVGLTLVPSLGGFMGAYFVRGEGLRWYASLQKPSWHPPRWTLAPIWGTLYSAM
GYGSYIIWKELGGFTEEAMVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLMLVSGVAT
ATTLAWHRVSPPAARLLYPYLAWLAFATMLNYYVWRDNSGRRGGSRLTE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM150167
n/a
NameBDBM150167
Synonyms:US8980887, Compound 10
TypeSmall organic molecule
Emp. Form.C24H22Cl2N4O
Mol. Mass.453.364
SMILESCCN(Cc1ccncc1)C(=O)Cc1c(nc2cc(C)ccn12)-c1ccc(Cl)c(Cl)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: