| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Translocator protein |
|---|
| Ligand | BDBM150170 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Competitive Binding Assay |
|---|
| Temperature | 303.15±n/a K |
|---|
| Ki | 38.73±n/a nM |
|---|
| IC50 | 91.02±n/a nM |
|---|
| Comments | extracted |
|---|
| Citation |  Yang, R; Li, Y; Li, Y; Zhao, N; Yun, L; Qin, J; Feng, Z; Zhang, Y 2-aryl imidazo[1,2-a]pyridine-3-acetamide derivatives, preparation methods and uses thereof US Patent US8980887 Publication Date 3/17/2015 |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Translocator protein |
|---|
| Name: | Translocator protein |
|---|
| Synonyms: | Benzodiazepine receptors; peripheral & central | Bzrp | Mbr | Mitochondrial benzodiazepine receptor | PBR | PKBS | Peripheral benzodiazepine receptor (PBR) | Peripheral-Type Benzodiazepine Receptor | TSPO_RAT | Tspo |
|---|
| Type: | Mitochondrion membrane protein |
|---|
| Mol. Mass.: | 18945.84 |
|---|
| Organism: | Rattus norvegicus (rat) |
|---|
| Description: | Competitive binding experiments were performed on rat kidney mitochondrial membranes. |
|---|
| Residue: | 169 |
|---|
| Sequence: | MSQSWVPAVGLTLVPSLGGFMGAYFVRGEGLRWYASLQKPSWHPPRWTLAPIWGTLYSAM
GYGSYIIWKELGGFTEEAMVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLMLVSGVAT
ATTLAWHRVSPPAARLLYPYLAWLAFATMLNYYVWRDNSGRRGGSRLTE
|
|
|
|---|
| BDBM150170 |
|---|
| n/a |
|---|
| Name | BDBM150170 |
|---|
| Synonyms: | US8980887, Compound 14 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C25H26N4O |
|---|
| Mol. Mass. | 398.5001 |
|---|
| SMILES | CCN(Cc1ccccn1)C(=O)Cc1c(nc2cc(C)ccn12)-c1ccc(C)cc1 |
|---|
| Structure | 
|
|---|
Search and Browse
