Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHepatic Lipase (HL)
LigandBDBM151241
Substrate/Competitorn/a
Meas. Tech.Biological Assay
pH8±n/a
Temperature298.15±n/a K
IC50<10±n/a nM
Commentsextracted
Citation Finlay HJiang JKim SParkhurst BQiao JXWang TCPi ZTora GOLloyd JJohnson JA Amide, urea or sulfone amide linked benzothiazole inhibitors of endothelial lipase US Patent  US8987314 Publication Date 3/24/2015
More Info.:Get all data from this article,  Assay Method
 
Hepatic Lipase (HL)
Name:Hepatic Lipase (HL)
Synonyms:HL | Hepatic lipase | Hepatic triacylglycerol lipase | Lipase member C
Type:Protein
Mol. Mass.:55938.55
Organism:Homo sapiens (Human)
Description:P11150
Residue:499
Sequence:
MDTSPLCFSILLVLCIFIQSSALGQSLKPEPFGRRAQAVETNKTLHEMKTRFLLFGETNQ
GCQIRINHPDTLQECGFNSSLPLVMIIHGWSVDGVLENWIWQMVAALKSQPAQPVNVGLV
DWITLAHDHYTIAVRNTRLVGKEVAALLRWLEESVQLSRSHVHLIGYSLGAHVSGFAGSS
IGGTHKIGRITGLDAAGPLFEGSAPSNRLSPDDANFVDAIHTFTREHMGLSVGIKQPIGH
YDFYPNGGSFQPGCHFLELYRHIAQHGFNAITQTIKCSHERSVHLFIDSLLHAGTQSMAY
PCGDMNSFSQGLCLSCKKGRCNTLGYHVRQEPRSKSKRLFLVTRAQSPFKVYHYQFKIQF
INQTETPIQTTFTMSLLGTKEKMQKIPITLGKGIASNKTYSFLITLDVDIGELIMIKFKW
ENSAVWANVWDTVQTIIPWSTGPRHSGLVLKTIRVKAGETQQRMTFCSENTDDLLLRPTQ
EKIFVKCEIKSKTSKRKIR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM151241
n/a
NameBDBM151241
Synonyms:US8987314, B37
TypeSmall organic molecule
Emp. Form.C18H18FN3O5S3
Mol. Mass.471.546
SMILESCS(=O)(=O)C(C(=O)NCCS(N)(=O)=O)c1nc2ccc(cc2s1)-c1cccc(F)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: