Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMenin
LigandBDBM152231
Substrate/Competitorn/a
Meas. Tech.NMR Spectroscopy Assay
IC50 1100±n/a nM
Citation Grembecka JCierpicki THess J Compositions and methods for treatment of leukemia US Patent  US8993552 Publication Date 3/31/2015
More Info.:Get all data from this article,  Assay Method
 
Menin
Name:Menin
Synonyms:MEN1 | SCG2
Type:Protein
Mol. Mass.:68022.55
Organism:Homo sapiens (Human)
Description:O00255
Residue:615
Sequence:
MGLKAAQKTLFPLRSIDDVVRLFAAELGREEPDLVLLSLVLGFVEHFLAVNRVIPTNVPE
LTFQPSPAPDPPGGLTYFPVADLSIIAALYARFTAQIRGAVDLSLYPREGGVSSRELVKK
VSDVIWNSLSRSYFKDRAHIQSLFSFITGWSPVGTKLDSSGVAFAVVGACQALGLRDVHL
ALSEDHAWVVFGPNGEQTAEVTWHGKGNEDRRGQTVNAGVAERSWLYLKGSYMRCDRKME
VAFMVCAINPSIDLHTDSLELLQLQQKLLWLLYDLGHLERYPMALGNLADLEELEPTPGR
PDPLTLYHKGIASAKTYYRDEHIYPYMYLAGYHCRNRNVREALQAWADTATVIQDYNYCR
EDEEIYKEFFEVANDVIPNLLKEAASLLEAGEERPGEQSQGTQSQGSALQDPECFAHLLR
FYDGICKWEEGSPTPVLHVGWATFLVQSLGRFEGQVRQKVRIVSREAEAAEAEEPWGEEA
REGRRRGPRRESKPEEPPPPKKPALDKGLGTGQGAVSGPPRKPPGTVAGTARGPEGGSTA
QVPAPTASPPPEGPVLTFQSEKMKGMKELLVATKINSSAIKLQLTAQSQVQMKKQKVSTP
SDYTLSFLKRQRKGL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM152231
n/a
NameBDBM152231
Synonyms:US8993552, 66
TypeSmall organic molecule
Emp. Form.C15H15F3N6S2
Mol. Mass.400.445
SMILESCCc1cc2c(ncnc2s1)N1CCN(CC1)c1nnc(s1)C(F)(F)F
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: