Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAlpha-glucosidase MAL12
LigandBDBM152499
Substrate/Competitorn/a
Meas. Tech.alpha-Glucosidase Assay
IC50 3.0e+3± 1.5e+2 nM
Citation Rahim FMalik FUllah HWadood AKhan FJavid MTTaha MRehman WUr Rehman AKhan KM Isatin based Schiff bases as inhibitors of a-glucosidase: Synthesis, characterization, in vitro evaluation and molecular docking studies. Bioorg Chem 60:42-8 (2015) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Alpha-glucosidase MAL12
Name:Alpha-glucosidase MAL12
Synonyms:α-Glucosidase | Maltase | alpha-Glucosidase (α-Glucosidase)
Type:Protein
Mol. Mass.:68084.32
Organism:Saccharomyces cerevisiae
Description:P53341
Residue:584
Sequence:
MTISDHPETEPKWWKEATIYQIYPASFKDSNNDGWGDLKGITSKLQYIKDLGVDAIWVCP
FYDSPQQDMGYDISNYEKVWPTYGTNEDCFELIDKTHKLGMKFITDLVINHCSTEHEWFK
ESRSSKTNPKRDWFFWRPPKGYDAEGKPIPPNNWKSFFGGSAWTFDETTNEFYLRLFASR
QVDLNWENEDCRRAIFESAVGFWLDHGVDGFRIDTAGLYSKRPGLPDSPIFDKTSKLQHP
NWGSHNGPRIHEYHQELHRFMKNRVKDGREIMTVGEVAHGSDNALYTSAARYEVSEVFSF
THVEVGTSPFFRYNIVPFTLKQWKEAIASNFLFINGTDSWATTYIENHDQARSITRFADD
SPKYRKISGKLLTLLECSLTGTLYVYQGQEIGQINFKEWPIEKYEDVDVKNNYEIIKKSF
GKNSKEMKDFFKGIALLSRDHSRTPMPWTKDKPNAGFTGPDVKPWFLLNESFEQGINVEQ
ESRDDDSVLNFWKRALQARKKYKELMIYGYDFQFIDLDSDQIFSFTKEYEDKTLFAALNF
SGEEIEFSLPREGASLSFILGNYDDTDVSSRVLKPWEGRIYLVK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM152499
n/a
NameBDBM152499
Synonyms:(E)-N'-(2-oxoindolin-3-ylidene)dodecanehydrazide (20)
TypeSmall organic molecule
Emp. Form.C20H29N3O2
Mol. Mass.343.4632
SMILESCCCCCCCCCCCC(=O)N\N=C1\C(=O)Nc2ccccc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: