| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Peptidyl-prolyl cis-trans isomerase B |
|---|
| Ligand | BDBM286563 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Surface Plasmon Resonance (SPR) Assay |
|---|
| pH | 7.4±n/a |
|---|
| Kd | 0.600±n/a nM |
|---|
| Comments | extracted |
|---|
| Citation |  Fu, J; Karur, S; Li, X; Lu, P; Mergo, W; Rivkin, A; Sweeney, ZK; Tjandra, M; Weiss, A; Yifru, A Cyclic peptides and use as medicines US Patent US9566312 Publication Date 2/14/2017 |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Peptidyl-prolyl cis-trans isomerase B |
|---|
| Name: | Peptidyl-prolyl cis-trans isomerase B |
|---|
| Synonyms: | CYP-S1 | CYPB | Cyclophilin B | Cyclophilin B (CypB) | PPIB | PPIB_HUMAN | PPIase | Peptidyl-prolyl cis-trans isomerase B | Rotamase | S-cyclophilin | SCYLP |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 23751.82 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P23284 |
|---|
| Residue: | 216 |
|---|
| Sequence: | MLRLSERNMKVLLAAALIAGSVFFLLLPGPSAADEKKKGPKVTVKVYFDLRIGDEDVGRV
IFGLFGKTVPKTVDNFVALATGEKGFGYKNSKFHRVIKDFMIQGGDFTRGDGTGGKSIYG
ERFPDENFKLKHYGPGWVSMANAGKDTNGSQFFITTVKTAWLDGKHVVFGKVLEGMEVVR
KVESTKTDSRDKPLKDVIIADCGKIEVEKPFAIAKE
|
|
|
|---|
| BDBM286563 |
|---|
| n/a |
|---|
| Name | BDBM286563 |
|---|
| Synonyms: | US9566312, Compound 2.8.2 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C69H126N12O15S |
|---|
| Mol. Mass. | 1395.875 |
|---|
| SMILES | CC[C@H](NC(=O)C([C@H](O)[C@H](C)C\C=C\C)N(C)C(=O)[C@H](C(C)C)N(C)C(=O)[C@H](CC(C)C)N(C)C(=O)[C@H](CC(C)C)N(C)C(=O)[C@@H](C)NC(=O)[C@H](C)NC(=O)[C@H](CC(C)C)N(C)C(=O)[C@@H](NC(=O)[C@@H](NC)[C@H](C)COCCN1CCS(=O)(=O)CC1)C(C)C)C(=O)N(C)[C@H](C)C(C)=O |r| |
|---|
| Structure | 
|
|---|
Search and Browse
