Reaction Details |
| Report a problem with these data |
Target | Peptidyl-prolyl cis-trans isomerase B |
---|
Ligand | BDBM286599 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | Surface Plasmon Resonance (SPR) Assay |
---|
pH | 7.4±n/a |
---|
Kd | 0.600±n/a nM |
---|
Comments | extracted |
---|
Citation | Fu, J; Karur, S; Li, X; Lu, P; Mergo, W; Rivkin, A; Sweeney, ZK; Tjandra, M; Weiss, A; Yifru, A Cyclic peptides and use as medicines US Patent US9566312 Publication Date 2/14/2017 |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Peptidyl-prolyl cis-trans isomerase B |
---|
Name: | Peptidyl-prolyl cis-trans isomerase B |
Synonyms: | CYP-S1 | CYPB | Cyclophilin B | Cyclophilin B (CypB) | PPIB | PPIB_HUMAN | PPIase | Peptidyl-prolyl cis-trans isomerase B | Rotamase | S-cyclophilin | SCYLP |
Type: | Protein |
Mol. Mass.: | 23751.82 |
Organism: | Homo sapiens (Human) |
Description: | P23284 |
Residue: | 216 |
Sequence: | MLRLSERNMKVLLAAALIAGSVFFLLLPGPSAADEKKKGPKVTVKVYFDLRIGDEDVGRV
IFGLFGKTVPKTVDNFVALATGEKGFGYKNSKFHRVIKDFMIQGGDFTRGDGTGGKSIYG
ERFPDENFKLKHYGPGWVSMANAGKDTNGSQFFITTVKTAWLDGKHVVFGKVLEGMEVVR
KVESTKTDSRDKPLKDVIIADCGKIEVEKPFAIAKE
|
|
|
BDBM286599 |
---|
n/a |
---|
Name | BDBM286599 |
Synonyms: | US9566312, Compound 2.18.3 |
Type | Small organic molecule |
Emp. Form. | C70H127N13O13 |
Mol. Mass. | 1358.8367 |
SMILES | CC[C@@H]1NC(=O)[C@H]([C@H](O)[C@H](C)C\C=C\C)N(C)C(=O)[C@H](C(C)C)N(C)C(=O)[C@H](CC(C)C)N(C)C(=O)[C@H](CC(C)C)N(C)C(=O)[C@@H](C)NC(=O)[C@H](C)NC(=O)[C@H](CC(C)C)N(C)C(=O)[C@@H](NC(=O)[C@H]([C@H](C)CCN2CCN(CCOC)CC2)N(C)C(=O)[C@@H](C)N(C)C1=O)C(C)C |r| |
Structure |
|