Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMonoamine Oxidase Type B (MAO-B)
LigandBDBM8961
Substrate/Competitorn/a
Meas. Tech.Inhibition Assay
pH7.4±n/a
Temperature310.15±n/a K
IC50 499600±n/a nM
Commentsextracted
Citation Samadi AMarco Contelles JLBolea Tomás ILuque Garriga FJUnzeta López M Derivatives of propargylamine having neuroprotective capacity for the treatment of Alzheimer's and Parkinson's diseases US Patent  US8999994 Publication Date 4/7/2015
More Info.:Get all data from this article,  Assay Method
 
Monoamine Oxidase Type B (MAO-B)
Name:Monoamine oxidase
Synonyms:Amine oxidase (flavin-containing) B | Amine oxidase [flavin-containing] B | MAOB | Monoamine oxidase | Monoamine oxidase B (MAO-B) | Monoamine oxidase B (rMAO-B) | Monoamine oxidase type B (MAOB) | Monoamine oxidase-B (MAO-B)
Type:Enzyme
Mol. Mass.:58469.65
Organism:Rattus norvegicus (rat)
Description:P19643
Residue:520
Sequence:
MSNKCDVIVVGGGISGMAAAKLLHDCGLSVVVLEARDRVGGRTYTIRNKNVKYVDLGGSY
VGPTQNRILRLAKELGLETYKVNEVERLIHFVKGKSYAFRGPFPPVWNPITYLDYNNLWR
TMDEMGQEIPSDAPWKAPLAEEWDYMTMKELLDKICWTNSTKQIATLFVNLCVTAETHEV
SALWFLWYVKQCGGTTRIISTTNGGQERKFIGGSGQVSERIKDILGDRVKLERPVIHIDQ
TGENVVVKTLNHEIYEAKYVISAIPPVLGMKIHHSPPLPILRNQLITRVPLGSVIKCMVY
YKEPFWRKKDFCGTMVIEGEEAPIAYTLDDTKPDGSCAAIMGFILAHKARKLVRLTKEER
LRKLCELYAKVLNSQEALQPVHYEEKNWCEEQYSGGCYTAYFPPGILTQYGRVLRQPVGK
IFFAGTETASHWSGYMEGAVEAGERAAREILHAIGKIPEDEIWQPEPESVDVPARPITNT
FLERHLPSVPGLLKLLGLTTILSATALGFLAHKKGLFVRF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM8961
n/a
NameBDBM8961
Synonyms:1,2,3,4-tetrahydro-9-acridinamine | 1,2,3,4-tetrahydroacridin-9-amine | 9-THA | 9-amino-1,2,3,4-tetrahydroacridine (THA) | CHEMBL1337960 | CHEMBL95 | Cognex | Tacrine | Tracine | US8999994, Tacrine | cid_1935 | tacrine.HCl
TypeSmall organic molecule
Emp. Form.C13H14N2
Mol. Mass.198.2637
SMILESNc1c2CCCCc2nc2ccccc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: