Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMetallo-beta-lactamase VIM-24 (VIM-24)
LigandBDBM153700
Substrate/Competitorn/a
Meas. Tech.Direct Competition Assay
Ki 4.9e+3± 3e+2 nM
Citation Mojica MFMahler SGBethel CRTaracila MAKosmopoulou MPapp-Wallace KMLlarrull LIWilson BMMarshall SHWallace CJVillegas MVHarris MEVila AJSpencer JBonomo RA Exploring the Role of Residue 228 in Substrate and Inhibitor Recognition by VIM Metallo--lactamases. Biochemistry 54:3183-96 (2015) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Metallo-beta-lactamase VIM-24 (VIM-24)
Name:Metallo-beta-lactamase VIM-24 (VIM-24)
Synonyms:n/a
Type:Protein
Mol. Mass.:28273.97
Organism:Klebsiella pneumoniae (Enterobacteria)
Description:E0AFT6
Residue:266
Sequence:
MFKLLSKLLVYLTASIMAIASPLAFSVDSSGEYPTVSEIPVGEVRLYQIADGVWSHIATQ
SFDGAVYPSNGLIVRDGDELLLIDTAWGAKNTAALLAEIEKQIGLPVTRAVSTHFHDDRV
GGVDVLRAAGVATYASPSTRRLAEVEGNEIPTHSLEGLSSSGDAVRFGPVELFYPGAAHS
TDNLVVYVPSASVLYGGCAIYELSLTSAGNVADADLAEWPTSIERIQQHYPEAQFVIPGH
GLPGGLDLLKHTTNVVKAHTNRSVVE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM153700
n/a
NameBDBM153700
Synonyms:L-VC26
TypeSmall organic molecule
Emp. Form.C9H15NO2S3
Mol. Mass.265.416
SMILESCC1(C)S[C@H]2CS[C@H](CS)N2[C@@H]1C(O)=O |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: