| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Chromobox protein homolog 7 |
|---|
| Ligand | BDBM154563 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | AlphaScreen Assay |
|---|
| pH | 8±0 |
|---|
| Temperature | 1390.75±0 K |
|---|
| IC50 | >1.00e+5±n/a nM |
|---|
| Citation |  Perfetti, MT; Baughman, BM; Dickson, BM; Mu, Y; Cui, G; Mader, P; Dong, A; Norris, JL; Rothbart, SB; Strahl, BD; Brown, PJ; Janzen, WP; Arrowsmith, CH; Mer, G; McBride, KM; James, LI; Frye, SV Identification of a fragment-like small molecule ligand for the methyl-lysine binding protein, 53BP1. ACS Chem Biol10:1072-81 (2015) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| Chromobox protein homolog 7 |
|---|
| Name: | Chromobox protein homolog 7 |
|---|
| Synonyms: | CBX7 | CBX7_HUMAN | Chromobox protein homolog 7 | Chromobox protein homolog 7 (CBX7) |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 28351.76 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | n/a |
|---|
| Residue: | 251 |
|---|
| Sequence: | MELSAIGEQVFAVESIRKKRVRKGKVEYLVKWKGWPPKYSTWEPEEHILDPRLVMAYEEK
EERDRASGYRKRGPKPKRLLLQRLYSMDLRSSHKAKGKEKLCFSLTCPLGSGSPEGVVKA
GAPELVDKGPLVPTLPFPLRKPRKAHKYLRLSRKKFPPRGPNLESHSHRRELFLQEPPAP
DVLQAAGEWEPAAQPPEEEADADLAEGPPPWTPALPSSEVTVTDITANSITVTFREAQAA
EGFFRDRSGKF
|
|
|
|---|
| BDBM154563 |
|---|
| n/a |
|---|
| Name | BDBM154563 |
|---|
| Synonyms: | N-(3-(Tert-butylamino)propyl)-3-iodobenzamide (19) |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C14H21IN2O |
|---|
| Mol. Mass. | 360.2338 |
|---|
| SMILES | CC(C)(C)NCCCNC(=O)c1cccc(I)c1 |
|---|
| Structure | 
|
|---|
Search and Browse
