| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Proteasome subunit alpha type-2 |
|---|
| Ligand | BDBM154579 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChTL Inhibition Assays |
|---|
| pH | 7.5±n/a |
|---|
| IC50 | 164.5±5.6 nM |
|---|
| Comments | extracted |
|---|
| Citation |  Trivella, DB; Pereira, AR; Stein, ML; Kasai, Y; Byrum, T; Valeriote, FA; Tantillo, DJ; Groll, M; Gerwick, WH; Moore, BS Enzyme inhibition by hydroamination: design and mechanism of a hybrid carmaphycin-syringolin enone proteasome inhibitor. Chem Biol21:782-91 (2014) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Proteasome subunit alpha type-2 |
|---|
| Name: | Proteasome subunit alpha type-2 |
|---|
| Synonyms: | 20S proteasome | PRE8 | PRS4 | PSA2_YEAST |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 27159.02 |
|---|
| Organism: | Saccharomyces cerevisiae s288c (Yeast) |
|---|
| Description: | n/a |
|---|
| Residue: | 250 |
|---|
| Sequence: | MTDRYSFSLTTFSPSGKLGQIDYALTAVKQGVTSLGIKATNGVVIATEKKSSSPLAMSET
LSKVSLLTPDIGAVYSGMGPDYRVLVDKSRKVAHTSYKRIYGEYPPTKLLVSEVAKIMQE
ATQSGGVRPFGVSLLIAGHDEFNGFSLYQVDPSGSYFPWKATAIGKGSVAAKTFLEKRWN
DELELEDAIHIALLTLKESVEGEFNGDTIELAIIGDENPDLLGYTGIPTDKGPRFRKLTS
QEINDRLEAL
|
|
|
|---|
| BDBM154579 |
|---|
| n/a |
|---|
| Name | BDBM154579 |
|---|
| Synonyms: | (2S)-2-[(2S)-2-hexanamido-3-methylbutanamido]-N,N-dimethyl-N'-[(2S)-4-methyl-1-[(2R)-2-methyloxiran-2-yl]-1-oxopentan-2-yl]pentanediamide (3) | (2S)-N-[(4S)-2,6-dimethyl-3-oxohept-1-en-4-yl]-2-[(2S)-2-hexanamido-3-methylbutanamido]-N',N'-dimethylpentanediamide (4) |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C27H48N4O6 |
|---|
| Mol. Mass. | 524.6932 |
|---|
| SMILES | CCCCCC(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCC(=O)N(C)C)C(=O)N[C@@H](CC(C)C)C(=O)[C@@]1(C)CO1 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
