Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetOrexin receptor type 2
LigandBDBM154969
Substrate/Competitorn/a
Meas. Tech.In Vitro Assay
Temperature310.15±n/a K
IC50 4±n/a nM
Commentsextracted
Citation Boss CBrotschi CGatfield JGude MHeidmann BSifferlen TWilliams JT Proline sulfonamide derivatives as orexin receptor antagonists US Patent  US9000029 Publication Date 4/7/2015
More Info.:Get all data from this article,  Assay Method
 
Orexin receptor type 2
Name:Orexin receptor type 2
Synonyms:HCRTR2 | Hypocretin receptor type 2 | Orexin receptor type 2 (OR 2) | Orexin receptor type 2 (OR-2) | Orexin receptor type 2 (OX2) | Orexin receptor type 2 (OX2R) | Orexin receptor type 2 (OxR2) | Ox-2-R | Ox2-R
Type:Protein
Mol. Mass.:50710.53
Organism:Homo sapiens (Human)
Description:O43614
Residue:444
Sequence:
MSGTKLEDSPPCRNWSSASELNETQEPFLNPTDYDDEEFLRYLWREYLHPKEYEWVLIAG
YIIVFVVALIGNVLVCVAVWKNHHMRTVTNYFIVNLSLADVLVTITCLPATLVVDITETW
FFGQSLCKVIPYLQTVSVSVSVLTLSCIALDRWYAICHPLMFKSTAKRARNSIVIIWIVS
CIIMIPQAIVMECSTVFPGLANKTTLFTVCDERWGGEIYPKMYHICFFLVTYMAPLCLMV
LAYLQIFRKLWCRQIPGTSSVVQRKWKPLQPVSQPRGPGQPTKSRMSAVAAEIKQIRARR
KTARMLMIVLLVFAICYLPISILNVLKRVFGMFAHTEDRETVYAWFTFSHWLVYANSAAN
PIIYNFLSGKFREEFKAAFSCCCLGVHHRQEDRLTRGRTSTESRKSLTTQISNFDNISKL
SEQVVLTSISTLPAANGAGPLQNW
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM154969
n/a
NameBDBM154969
Synonyms:US9000029, 48
TypeSmall organic molecule
Emp. Form.C21H26N2O4S
Mol. Mass.402.507
SMILESCOc1ccc(C)cc1S(=O)(=O)N1CCC[C@H]1C(=O)Nc1cc(C)cc(C)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: