Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetProlylcarboxypeptidase (PRCP)
LigandBDBM155349
Substrate/Competitorn/a
Meas. Tech.Enzyme Activity Assay
pH5.5±n/a
IC50 0.7±n/a nM
Commentsextracted
Citation Debenham JSJiang JMadsen-Duggan CBShen D Prolylcarboxypeptidase inhibitors US Patent  US9006268 Publication Date 4/14/2015
More Info.:Get all data from this article,  Assay Method
 
Prolylcarboxypeptidase (PRCP)
Name:Lysosomal Pro-X carboxypeptidase
Synonyms:Angiotensinase C | Lysosomal carboxypeptidase C | PRCP | Proline carboxypeptidase | Prolylcarboxypeptidase
Type:Enzyme
Mol. Mass.:55805.19
Organism:Homo sapiens (Human)
Description:P42785
Residue:496
Sequence:
MGRRALLLLLLSFLAPWATIALRPALRALGSLHLPTNPTSLPAVAKNYSVLYFQQKVDHF
GFNTVKTFNQRYLVADKYWKKNGGSILFYTGNEGDIIWFCNNTGFMWDVAEELKAMLVFA
EHRYYGESLPFGDNSFKDSRHLNFLTSEQALADFAELIKHLKRTIPGAENQPVIAIGGSY
GGMLAAWFRMKYPHMVVGALAASAPIWQFEDLVPCGVFMKIVTTDFRKSGPHCSESIHRS
WDAINRLSNTGSGLQWLTGALHLCSPLTSQDIQHLKDWISETWVNLAMVDYPYASNFLQP
LPAWPIKVVCQYLKNPNVSDSLLLQNIFQALNVYYNYSGQVKCLNISETATSSLGTLGWS
YQACTEVVMPFCTNGVDDMFEPHSWNLKELSDDCFQQWGVRPRPSWITTMYGGKNISSHT
NIVFSNGELDPWSGGGVTKDITDTLVAVTISEGAHHLDLRTKNALDPMSVLLARSLEVRH
MKNWIRDFYDSAGKQH
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM155349
n/a
NameBDBM155349
Synonyms:US9006268, 21
TypeSmall organic molecule
Emp. Form.C26H26ClN5
Mol. Mass.443.971
SMILESClc1ccc(cc1)-c1nc(c([nH]1)C1CCN(CCc2ccccc2)CC1)-c1ncccn1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: