| Reaction Details |
|---|
 | Report a problem with these data |
| Target | N(G),N(G)-dimethylarginine dimethylaminohydrolase 1 |
|---|
| Ligand | BDBM34513 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Inhibition Assay |
|---|
| IC50 | 9900±n/a nM |
|---|
| Citation |  Ghebremariam, YT; Cooke, JP Dimethylarginine dimethylaminohydrolase inhibitors and methods of use thereof US Patent US9011882 Publication Date 4/21/2015 |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| N(G),N(G)-dimethylarginine dimethylaminohydrolase 1 |
|---|
| Name: | N(G),N(G)-dimethylarginine dimethylaminohydrolase 1 |
|---|
| Synonyms: | DDAH | DDAH1 | DDAH1_HUMAN | Dimethylarginine dimethylaminohydrolase (DDAH-1) | Dimethylarginine dimethylaminohydrolase 1 (DDAH) | Dimethylarginine dimethylaminohydrolase 1 (DDAH) E78A | Dimethylarginine dimethylaminohydrolase 1 (DDAH) L271G | Dimethylarginine dimethylaminohydrolase 1 (DDAH) L30A | Dimethylarginine dimethylaminohydrolase 1 (DDAH1) | N(G),N(G)-dimethylarginine dimethylaminohydrolase 1 |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 31116.90 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | O94760 |
|---|
| Residue: | 285 |
|---|
| Sequence: | MAGLGHPAAFGRATHAVVRALPESLGQHALRSAKGEEVDVARAERQHQLYVGVLGSKLGL
QVVELPADESLPDCVFVEDVAVVCEETALITRPGAPSRRKEVDMMKEALEKLQLNIVEMK
DENATLDGGDVLFTGREFFVGLSKRTNQRGAEILADTFKDYAVSTVPVADGLHLKSFCSM
AGPNLIAIGSSESAQKALKIMQQMSDHRYDKLTVPDDIAANCIYLNIPNKGHVLLHRTPE
EYPESAKVYEKLKDHMLIPVSMSELEKVDGLLTCCSVLINKKVDS
|
|
|
|---|
| BDBM34513 |
|---|
| n/a |
|---|
| Name | BDBM34513 |
|---|
| Synonyms: | MLS000118887 | N-[2-(2,5-dimethoxyphenyl)ethyl]-2-(3-keto-4,6-dimethyl-isothiazolo[5,4-b]pyridin-2-yl)acetamide | N-[2-(2,5-dimethoxyphenyl)ethyl]-2-(4,6-dimethyl-3-oxidanylidene-[1,2]thiazolo[5,4-b]pyridin-2-yl)ethanamide | N-[2-(2,5-dimethoxyphenyl)ethyl]-2-(4,6-dimethyl-3-oxo-2-isothiazolo[5,4-b]pyridinyl)acetamide | N-[2-(2,5-dimethoxyphenyl)ethyl]-2-(4,6-dimethyl-3-oxo-[1,2]thiazolo[5,4-b]pyridin-2-yl)acetamide | SMR000095827 | US9011882, Table 1, Compound 15 | cid_5309169 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C20H23N3O4S |
|---|
| Mol. Mass. | 401.479 |
|---|
| SMILES | COc1ccc(OC)c(CCNC(=O)Cn2sc3nc(C)cc(C)c3c2=O)c1 |
|---|
| Structure | 
|
|---|
Search and Browse
