| Reaction Details |
|---|
 | Report a problem with these data |
| Target | ATP-sensitive inward rectifier potassium channel 1 |
|---|
| Ligand | BDBM155928 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Electrophysiology Assay |
|---|
| pH | 7.4±n/a |
|---|
| IC50 | 36±n/a nM |
|---|
| Comments | extracted |
|---|
| Citation |  Pasternak, A; Zhu, Y; Shahripour, A; Tang, H; Yang, L; Walsh, SP; Teumelsan, NH Inhibitors of the renal outer medullary potassium channel US Patent US9018211 Publication Date 4/28/2015 |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| ATP-sensitive inward rectifier potassium channel 1 |
|---|
| Name: | ATP-sensitive inward rectifier potassium channel 1 |
|---|
| Synonyms: | ATP-regulated potassium channel ROM-K | ATP-sensitive inward rectifier potassium channel 1 | Inward rectifier K(+) channel Kir1.1 | KAB-1 | KCNJ1_RAT | Kcnj1 | Potassium channel (ATP modulatory) | Potassium channel, inwardly rectifying subfamily J member 1 | Renal Outer Medullary Potassium (ROMK) | Renal Outer Medullary Potassium (ROMK1) | Romk1 | The Renal Outer Medullary Potassium (ROMK) channel (Kir1.1) |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 44976.27 |
|---|
| Organism: | Rattus norvegicus (Rat) |
|---|
| Description: | P35560 |
|---|
| Residue: | 391 |
|---|
| Sequence: | MGASERSVFRVLIRALTERMFKHLRRWFITHIFGRSRQRARLVSKEGRCNIEFGNVDAQS
RFIFFVDIWTTVLDLKWRYKMTVFITAFLGSWFLFGLLWYVVAYVHKDLPEFYPPDNRTP
CVENINGMTSAFLFSLETQVTIGYGFRFVTEQCATAIFLLIFQSILGVIINSFMCGAILA
KISRPKKRAKTITFSKNAVISKRGGKLCLLIRVANLRKSLLIGSHIYGKLLKTTITPEGE
TIILDQTNINFVVDAGNENLFFISPLTIYHIIDHNSPFFHMAAETLSQQDFELVVFLDGT
VESTSATCQVRTSYVPEEVLWGYRFVPIVSKTKEGKYRVDFHNFGKTVEVETPHCAMCLY
NEKDARARMKRGYDNPNFVLSEVDETDDTQM
|
|
|
|---|
| BDBM155928 |
|---|
| n/a |
|---|
| Name | BDBM155928 |
|---|
| Synonyms: | US9018211, 52 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C24H28N4O5 |
|---|
| Mol. Mass. | 452.5029 |
|---|
| SMILES | COc1cc(ncc1C#N)[C@@H](O)CN1CCN(C[C@H](O)c2ccc3C(=O)OCc3c2C)CC1 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
