Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetNF-kappa-beta-inducing kinase (NF-kB)
LigandBDBM159164
Substrate/Competitorn/a
Meas. Tech.Inhibition Assay
pH7.2±n/a
Ki 0.2±n/a nM
Commentsextracted
Citation Staben SCastanedo GMontalbetti CAFeng J Tricyclic compounds and methods of use therefor US Patent  US9034866 Publication Date 5/19/2015
More Info.:Get all data from this article,  Assay Method
 
NF-kappa-beta-inducing kinase (NF-kB)
Name:NF-kappa-beta-inducing kinase (NF-kB)
Synonyms:Mitogen-activated protein kinase kinase kinase 14
Type:Protein
Mol. Mass.:104059.50
Organism:Homo sapiens (Human)
Description:Q99558
Residue:947
Sequence:
MAVMEMACPGAPGSAVGQQKELPKAKEKTPPLGKKQSSVYKLEAVEKSPVFCGKWEILND
VITKGTAKEGSEAGPAAISIIAQAECENSQEFSPTFSERIFIAGSKQYSQSESLDQIPNN
VAHATEGKMARVCWKGKRRSKARKKRKKKSSKSLAHAGVALAKPLPRTPEQESCTIPVQE
DESPLGAPYVRNTPQFTKPLKEPGLGQLCFKQLGEGLRPALPRSELHKLISPLQCLNHVW
KLHHPQDGGPLPLPTHPFPYSRLPHPFPFHPLQPWKPHPLESFLGKLACVDSQKPLPDPH
LSKLACVDSPKPLPGPHLEPSCLSRGAHEKFSVEEYLVHALQGSVSSGQAHSLTSLAKTW
AARGSRSREPSPKTEDNEGVLLTEKLKPVDYEYREEVHWATHQLRLGRGSFGEVHRMEDK
QTGFQCAVKKVRLEVFRAEELMACAGLTSPRIVPLYGAVREGPWVNIFMELLEGGSLGQL
VKEQGCLPEDRALYYLGQALEGLEYLHSRRILHGDVKADNVLLSSDGSHAALCDFGHAVC
LQPDGLGKSLLTGDYIPGTETHMAPEVVLGRSCDAKVDVWSSCCMMLHMLNGCHPWTQFF
RGPLCLKIASEPPPVREIPPSCAPLTAQAIQEGLRKEPIHRVSAAELGGKVNRALQQVGG
LKSPWRGEYKEPRHPPPNQANYHQTLHAQPRELSPRAPGPRPAEETTGRAPKLQPPLPPE
PPEPNKSPPLTLSKEESGMWEPLPLSSLEPAPARNPSSPERKATVPEQELQQLEIELFLN
SLSQPFSLEEQEQILSCLSIDSLSLSDDSEKNPSKASQSSRDTLSSGVHSWSSQAEARSS
SWNMVLARGRPTDTPSYFNGVKVQIQSLNGEHLHIREFHRVKVGDIATGISSQIPAAAFS
LVTKDGQPVRYDMEVPDSGIDLQCTLAPDGSFAWSWRVKHGQLENRP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM159164
n/a
NameBDBM159164
Synonyms:US9034866, 641
TypeSmall organic molecule
Emp. Form.C19H14F3N3O4S
Mol. Mass.437.392
SMILESCN1CC[C@@](O)(C#Cc2cc3-c4nc(sc4C(F)(F)COc3cc2F)C(N)=O)C1=O |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: