Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSodium/glucose cotransporter 2 (SGLT2)
LigandBDBM159472
Substrate/Competitorn/a
Meas. Tech.Inhibition Assay
pH7.4±n/a
Temperature310.15±n/a K
IC50 0.308±n/a nM
Commentsextracted
Citation Choi SSong KSLee SHKim MJSeo HJPark EKong YPark SOKang HJung MELee KKim HJLee JSLee MWKim MHong DHKang M Diphenylmethane derivatives as SGLT2 inhibitors US Patent  US9034921 Publication Date 5/19/2015
More Info.:Get all data from this article,  Assay Method
 
Sodium/glucose cotransporter 2 (SGLT2)
Name:Sodium/glucose cotransporter 2 (SGLT2)
Synonyms:Na(+)/glucose cotransporter 2 | Sodium-Dependent Glucose Cotransporter 2 (SGLT2) | Sodium-dependent glucose cotransporter 2 (SGLT2) | Sodium/glucose cotransporter 1 (SGLT1) | Sodium/glucose cotransporter 2 | Solute carrier family 5 member 2
Type:Protein
Mol. Mass.:72902.00
Organism:Homo sapiens (Human)
Description:P31639
Residue:672
Sequence:
MEEHTEAGSAPEMGAQKALIDNPADILVIAAYFLLVIGVGLWSMCRTNRGTVGGYFLAGR
SMVWWPVGASLFASNIGSGHFVGLAGTGAASGLAVAGFEWNALFVVLLLGWLFAPVYLTA
GVITMPQYLRKRFGGRRIRLYLSVLSLFLYIFTKISVDMFSGAVFIQQALGWNIYASVIA
LLGITMIYTVTGGLAALMYTDTVQTFVILGGACILMGYAFHEVGGYSGLFDKYLGAATSL
TVSEDPAVGNISSFCYRPRPDSYHLLRHPVTGDLPWPALLLGLTIVSGWYWCSDQVIVQR
CLAGKSLTHIKAGCILCGYLKLTPMFLMVMPGMISRILYPDEVACVVPEVCRRVCGTEVG
CSNIAYPRLVVKLMPNGLRGLMLAVMLAALMSSLASIFNSSSTLFTMDIYTRLRPRAGDR
ELLLVGRLWVVFIVVVSVAWLPVVQAAQGGQLFDYIQAVSSYLAPPVSAVFVLALFVPRV
NEQGAFWGLIGGLLMGLARLIPEFSFGSGSCVQPSACPAFLCGVHYLYFAIVLFFCSGLL
TLTVSLCTAPIPRKHLHRLVFSLRHSKEEREDLDADEQQGSSLPVQNGCPESAMEMNEPQ
APAPSLFRQCLLWFCGMSRGGVGSPPPLTQEEAAAAARRLEDISEDPSWARVVNLNALLM
MAVAVFLWGFYA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM159472
n/a
NameBDBM159472
Synonyms:US9034921, E114
TypeSmall organic molecule
Emp. Form.C22H27ClO6S
Mol. Mass.454.964
SMILESCCOc1ccc(Cc2cc(cc(OC)c2Cl)[C@@H]2O[C@H](SC)[C@@H](O)[C@H](O)[C@H]2O)cc1 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: