Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetP2X purinoceptor 7 (P2X7)
LigandBDBM160085
Substrate/Competitorn/a
Meas. Tech.Radioligand Binding Assay
Ki 1±n/a nM
Citation Ameriks MKRech JCSavall BM [1,2,4]triazolo[4,3-a]pyrazines as P2X7 modulators US Patent  US9040534 Publication Date 5/26/2015
More Info.:Get all data from this article,  Assay Method
 
P2X purinoceptor 7 (P2X7)
Name:P2X purinoceptor 7
Synonyms:ATP receptor | P2X purinoceptor 7 | P2X purinoceptor 7 (P2RX7) | P2X7 | P2Z receptor | Purinergic receptor
Type:Protein
Mol. Mass.:68403.50
Organism:Rattus norvegicus (Rat)
Description:Q64663
Residue:595
Sequence:
MPACCSWNDVFQYETNKVTRIQSVNYGTIKWILHMTVFSYVSFALMSDKLYQRKEPLISS
VHTKVKGVAEVTENVTEGGVTKLVHGIFDTADYTLPLQGNSFFVMTNYLKSEGQEQKLCP
EYPSRGKQCHSDQGCIKGWMDPQSKGIQTGRCIPYDQKRKTCEIFAWCPAEEGKEAPRPA
LLRSAENFTVLIKNNIDFPGHNYTTRNILPGMNISCTFHKTWNPQCPIFRLGDIFQEIGE
NFTEVAVQGGIMGIEIYWDCNLDSWSHRCQPKYSFRRLDDKYTNESLFPGYNFRYAKYYK
ENGMEKRTLIKAFGVRFDILVFGTGGKFDIIQLVVYIGSTLSYFGLATVCIDLIINTYAS
TCCRSRVYPSCKCCEPCAVNEYYYRKKCEPIVEPKPTLKYVSFVDEPHIWMVDQQLLGKS
LQDVKGQEVPRPQTDFLELSRLSLSLHHSPPIPGQPEEMQLLQIEAVPRSRDSPDWCQCG
NCLPSQLPENRRALEELCCRRKPGQCITTSELFSKIVLSREALQLLLLYQEPLLALEGEA
INSKLRHCAYRSYATWRFVSQDMADFAILPSCCRWKIRKEFPKTQGQYSGFKYPY
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM160085
n/a
NameBDBM160085
Synonyms:US10047092, 26 | US10053463, 26 | US9040534, 26
TypeSmall organic molecule
Emp. Form.C18H16ClF3N6O
Mol. Mass.424.807
SMILESC[C@H]1Cn2c(nnc2C(=O)N1Cc1cccc(c1Cl)C(F)(F)F)-c1cc(C)[nH]n1 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: