Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetE3 ubiquitin-protein ligase Mdm2
LigandBDBM162072
Substrate/Competitorn/a
Meas. Tech.Time Resolved Fluorescence Energy Transfer (TR-FRET) Assay
IC50 2.9±n/a nM
Citation Berghausen JBuschmann NFuret PGessier FHergovich Lisztwan JHolzer PJacoby EKallen JMasuya KPissot Soldermann CRen HStutz S Substituted isoquinolinones and quinazolinones US Patent  US9051279 Publication Date 6/9/2015
More Info.:Get all data from this article,  Assay Method
 
E3 ubiquitin-protein ligase Mdm2
Name:MDM2-MDMX
Synonyms:Double minute 2 protein | Double minute 2 protein (HDM2) | E3 ubiquitin-protein ligase Mdm2 (p53-binding protein Mdm2) | Hdm2 | Human Double Minute 2 (HDM2) | p53-Binding Protein MDM2 | p53-binding protein
Type:Oncoprotein
Mol. Mass.:55196.54
Organism:Homo sapiens (Human)
Description:n/a
Residue:491
Sequence:
MCNTNMSVPTDGAVTTSQIPASEQETLVRPKPLLLKLLKSVGAQKDTYTMKEVLFYLGQY
IMTKRLYDEKQQHIVYCSNDLLGDLFGVPSFSVKEHRKIYTMIYRNLVVVNQQESSDSGT
SVSENRCHLEGGSDQKDLVQELQEEKPSSSHLVSRPSTSSRRRAISETEENSDELSGERQ
RKRHKSDSISLSFDESLALCVIREICCERSSSSESTGTPSNPDLDAGVSEHSGDWLDQDS
VSDQFSVEFEVESLDSEDYSLSEEGQELSDEDDEVYQVTVYQAGESDTDSFEEDPEISLA
DYWKCTSCNEMNPPLPSHCNRCWALRENWLPEDKGKDKGEISEKAKLENSTQAEEGFDVP
DCKKTIVNDSRESCVEENDDKITQASQSQESEDYSQPSTSSSIIYSSQEDVKEFEREETQ
DKEESVESSLPLNAIEPCVICQGRPKNGCIVHGKTGHLMACFTCAKKLKKRNKPCPVCRQ
PIQMIVLTYFP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM162072
n/a
NameBDBM162072
Synonyms:US9051279, 80
TypeSmall organic molecule
Emp. Form.C37H46ClN3O5
Mol. Mass.648.231
SMILESCOC(=O)CN(C)[C@H]1CC[C@H](CN(C)c2ccc(cc2)N2[C@@H](c3ccc(Cl)cc3)c3cc(OC(C)C)c(OC)cc3CC2=O)CC1 |r,wU:7.6,wD:21.22,10.10,(-3.33,6.16,;-4.67,6.93,;-6,6.16,;-7.34,6.93,;-6,4.62,;-7.34,3.85,;-8.65,4.62,;-7.34,2.31,;-6,1.54,;-6,,;-7.34,-.77,;-7.34,-2.31,;-6,-3.08,;-6,-4.62,;-4.67,-2.31,;-4.67,-.77,;-3.33,,;-2,-.77,;-2,-2.31,;-3.33,-3.08,;-.67,,;.67,-.77,;.67,-2.31,;-.67,-3.08,;-.67,-4.62,;.67,-5.39,;.67,-6.93,;2,-4.62,;2,-3.08,;2,,;3.33,-.77,;4.67,,;6,-.77,;7.34,,;8.67,-.77,;7.34,1.54,;4.67,1.54,;6,2.31,;6,3.85,;3.33,2.31,;2,1.54,;.67,2.31,;-.67,1.54,;-2,2.31,;-8.67,,;-8.67,1.54,)|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: