Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetE3 ubiquitin-protein ligase Mdm2
LigandBDBM162222
Substrate/Competitorn/a
Meas. Tech.Time Resolved Fluorescence Energy Transfer (TR-FRET) Assay
IC50 3.8±n/a nM
Citation Berghausen JBuschmann NFuret PGessier FHergovich Lisztwan JHolzer PJacoby EKallen JMasuya KPissot Soldermann CRen HStutz S Substituted isoquinolinones and quinazolinones US Patent  US9051279 Publication Date 6/9/2015
More Info.:Get all data from this article,  Assay Method
 
E3 ubiquitin-protein ligase Mdm2
Name:MDM2-MDMX
Synonyms:Double minute 2 protein | Double minute 2 protein (HDM2) | E3 ubiquitin-protein ligase Mdm2 (p53-binding protein Mdm2) | Hdm2 | Human Double Minute 2 (HDM2) | p53-Binding Protein MDM2 | p53-binding protein
Type:Oncoprotein
Mol. Mass.:55196.54
Organism:Homo sapiens (Human)
Description:n/a
Residue:491
Sequence:
MCNTNMSVPTDGAVTTSQIPASEQETLVRPKPLLLKLLKSVGAQKDTYTMKEVLFYLGQY
IMTKRLYDEKQQHIVYCSNDLLGDLFGVPSFSVKEHRKIYTMIYRNLVVVNQQESSDSGT
SVSENRCHLEGGSDQKDLVQELQEEKPSSSHLVSRPSTSSRRRAISETEENSDELSGERQ
RKRHKSDSISLSFDESLALCVIREICCERSSSSESTGTPSNPDLDAGVSEHSGDWLDQDS
VSDQFSVEFEVESLDSEDYSLSEEGQELSDEDDEVYQVTVYQAGESDTDSFEEDPEISLA
DYWKCTSCNEMNPPLPSHCNRCWALRENWLPEDKGKDKGEISEKAKLENSTQAEEGFDVP
DCKKTIVNDSRESCVEENDDKITQASQSQESEDYSQPSTSSSIIYSSQEDVKEFEREETQ
DKEESVESSLPLNAIEPCVICQGRPKNGCIVHGKTGHLMACFTCAKKLKKRNKPCPVCRQ
PIQMIVLTYFP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM162222
n/a
NameBDBM162222
Synonyms:US9051279, 205
TypeSmall organic molecule
Emp. Form.C38H46ClN5O5
Mol. Mass.688.255
SMILESCOc1cc2CC(=O)N([C@@H](c3ccc(Cl)cc3)c2cc1OCC1CCCO1)c1ccc(nc1)N(C)C[C@H]1CC[C@@H](CC1)N1CN(C)C(=O)C1 |r,wU:39.47,wD:9.9,36.40,(10.77,4.75,;9.44,5.52,;8.11,4.75,;6.77,5.52,;5.44,4.75,;4.1,5.52,;2.77,4.75,;1.44,5.52,;2.77,3.21,;4.1,2.44,;4.1,.9,;2.77,.13,;2.77,-1.41,;4.1,-2.18,;4.1,-3.72,;5.44,-1.41,;5.44,.13,;5.44,3.21,;6.77,2.44,;8.11,3.21,;9.44,2.44,;9.44,.9,;10.77,.13,;12.24,.61,;13.14,-.64,;12.24,-1.88,;10.77,-1.41,;1.44,2.44,;.1,3.21,;-1.23,2.44,;-1.23,.9,;.1,.13,;1.44,.9,;-2.56,.13,;-2.56,-1.41,;-3.9,.9,;-5.23,.13,;-6.57,.9,;-7.9,.13,;-7.9,-1.41,;-6.57,-2.18,;-5.23,-1.41,;-9.23,-2.18,;-9.23,-3.72,;-10.7,-4.19,;-11.47,-5.52,;-11.6,-2.95,;-13.14,-2.95,;-10.7,-1.7,)|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: