Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHDAC2/NCOR2
LigandBDBM163619
Substrate/Competitorn/a
Meas. Tech.HDAC Activity Assays
IC50 1.33e+3± 0 nM
Citation Wang YStowe RLPinello CETian GMadoux FLi DZhao LYLi JLWang YWang YMa HHodder PRoush WRLiao D Identification of histone deacetylase inhibitors with benzoylhydrazide scaffold that selectively inhibit class I histone deacetylases. Chem Biol 22:273-84 (2015) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
HDAC2/NCOR2
Name:HDAC2/NCOR2
Synonyms:n/a
Type:Protein
Mol. Mass.:n/a
Description:BPS Bioscience
Components:This complex has 2 components.
Component 1
Name:Histone deacetylase 2
Synonyms:HD2 | HDAC2 | Histone deacetylase 2 (HDAC2) | Human HDAC2
Type:Chromatin regulator; hydrolase; repressor
Mol. Mass.:55356.54
Organism:Homo sapiens (Human)
Description:The assay was performed using isolated HDAC2 that had been expressed as full-length 6x His-tagged fusion proteins in a baculovirus expression system in Sf9 cells.
Residue:488
Sequence:
MAYSQGGGKKKVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKA
TAEEMTKYHSDEYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVA
GAVKLNRQQTDMAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHH
GDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNFPMRDGIDDESYGQ
IFKPIISKVMEMYQPSAVVLQCGADSLSGDRLGCFNLTVKGHAKCVEVVKTFNLPLLMLG
GGGYTIRNVARCWTYETAVALDCEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTPEYM
EKIKQRLFENLRMLPHAPGVQMQAIPEDAVHEDSGDEDGEDPDKRISIRASDKRIACDEE
FSDSEDEGEGGRRNVADHKKGAKKARIEEDKKETEDKKTDVKEEDKSKDNSGEKTDTKGT
KSEQLSNP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
Component 2
Name:Deacetylase activation domain (NCOR2)
Synonyms:Nuclear receptor corepressor 2
Type:Protein
Mol. Mass.:12719.17
Organism:Homo sapiens (Human)
Description:Deacetylase activation domain of human NCOR2 (395-498aa)
Residue:104
Sequence:
IPPMLYDADQQRIKFINMNGLMADPMKVYKDRQVMNMWSEQEKETFREKFMQHPKNFGLI
ASFLERKTVAECVLYYYLTKKNENYKSLVRRSYRRRGKSQQQQQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM163619
n/a
NameBDBM163619
Synonyms:UF010
TypeSmall organic molecule
Emp. Form.C11H15BrN2O
Mol. Mass.271.154
SMILESCCCCNNC(=O)c1ccc(Br)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: