Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHDAC3/NCOR2
LigandBDBM163633
Substrate/Competitorn/a
Meas. Tech.HDAC Activity Assays
IC50 6.98e+3± 0 nM
Citation Wang YStowe RLPinello CETian GMadoux FLi DZhao LYLi JLWang YWang YMa HHodder PRoush WRLiao D Identification of histone deacetylase inhibitors with benzoylhydrazide scaffold that selectively inhibit class I histone deacetylases. Chem Biol 22:273-84 (2015) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
HDAC3/NCOR2
Name:HDAC3/NCOR2
Synonyms:n/a
Type:Protein
Mol. Mass.:n/a
Description:BPS Bioscience
Components:This complex has 2 components.
Component 1
Name:Histone deacetylase 1/2/3
Synonyms:HD3 | Histone deacetylase 3 (HDAC3) | Human HDAC3 | RPD3-2 | SMAP45
Type:Enzyme
Mol. Mass.:48829.55
Organism:Homo sapiens (Human)
Description:n/a
Residue:428
Sequence:
MAKTVAYFYDPDVGNFHYGAGHPMKPHRLALTHSLVLHYGLYKKMIVFKPYQASQHDMCR
FHSEDYIDFLQRVSPTNMQGFTKSLNAFNVGDDCPVFPGLFEFCSRYTGASLQGATQLNN
KICDIAINWAGGLHHAKKFEASGFCYVNDIVIGILELLKYHPRVLYIDIDIHHGDGVQEA
FYLTDRVMTVSFHKYGNYFFPGTGDMYEVGAESGRYYCLNVPLRDGIDDQSYKHLFQPVI
NQVVDFYQPTCIVLQCGADSLGCDRLGCFNLSIRGHGECVEYVKSFNIPLLVLGGGGYTV
RNVARCWTYETSLLVEEAISEELPYSEYFEYFAPDFTLHPDVSTRIENQNSRQYLDQIRQ
TIFENLKMLNHAPSVQIHDVPADLLTYDRTDEADAEERGPEENYSRPEAPNEFYDGDHDN
DKESDVEI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
Component 2
Name:Deacetylase activation domain (NCOR2)
Synonyms:Nuclear receptor corepressor 2
Type:Protein
Mol. Mass.:12719.17
Organism:Homo sapiens (Human)
Description:Deacetylase activation domain of human NCOR2 (395-498aa)
Residue:104
Sequence:
IPPMLYDADQQRIKFINMNGLMADPMKVYKDRQVMNMWSEQEKETFREKFMQHPKNFGLI
ASFLERKTVAECVLYYYLTKKNENYKSLVRRSYRRRGKSQQQQQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM163633
n/a
NameBDBM163633
Synonyms:SR-3364
TypeSmall organic molecule
Emp. Form.C13H17BrN2O
Mol. Mass.297.191
SMILESBrc1ccc(cc1)C(=O)NNCC1CCCC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: