Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetBeta-glucuronidase (CpGUS)
LigandBDBM163638
Substrate/Competitorn/a
Meas. Tech.Inhibition Assays
Ki 7.8e+3± 9e+2 nM
Citation Wallace BDRoberts ABPollet RMIngle JDBiernat KAPellock SJVenkatesh MKGuthrie LO'Neal SKRobinson SJDollinger MFigueroa EMcShane SRCohen RDJin JFrye SVZamboni WCPepe-Ranney CMani SKelly LRedinbo MR Structure and Inhibition of Microbiome -Glucuronidases Essential to the Alleviation of Cancer Drug Toxicity. Chem Biol 22:1238-49 (2015) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Beta-glucuronidase (CpGUS)
Name:Beta-glucuronidase (CpGUS)
Synonyms:n/a
Type:Protein
Mol. Mass.:68709.58
Organism:Clostridium perfringens (Firmicutes)
Description:A0A0N9KAE4
Residue:599
Sequence:
MLYPIITESRQLIDLSGIWKFKLNEGNGLTEELSKAPLEDTIEMAVPSSYNDLVESQEVR
DHVGWVWYERNFTIPKTLLNERIVLRFGSATHEAKVYLNGELLVEHKGGFTPFEAEINDL
LVSGDNRLTVAVNNIIDETTLPVGLVKEVEIDGKKVIKNSVNFDFFNYAGIHRPVKIYTT
PKSYVEDITIVTDFKENNGYVNYEVQAVGKCNIKVTIIDEENNIVAEGEGKEGKLTINNV
HLWEPMNAYLYKLKVELLDDEEIIDTYFEEFGVRTVEVKDGKFLINNKPFYFKGFGKHED
SYVNGRGINEAINIKDFNLMKWIGANSFRTSHYPYSEEIMRLADREGIVVIDETPAVGLH
LNFMATGFGGDAPKRDTWKEIGTKEAHERILRELVSRDKNHPCVVMWSVANEPDSDSEGA
KEYFEPLIKLTKELDPQKRPVTVVTYLMSTPDRCKVGDIVDVLCLNRYYGWYVAGGDLEE
AKRMLEDELKGWEERCPKTPIMFTEYGADTVAGLHDTVPVMFTEEYQVEYYKANHEVMDK
CKNFVGEQVWNFADFATSQGIIRVQGNKKGIFTRERKPKMIAHSLRERWTNIPEFGYKK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM163638
n/a
NameBDBM163638
Synonyms:1(2Fluorophenyl)3(2hydroxyethyl)3[(6methyl2oxo1,2dihydroquinolin3yl)methyl]thiourea (Inh 3)
TypeSmall organic molecule
Emp. Form.C20H20FN3O2S
Mol. Mass.385.455
SMILESCc1ccc2[nH]c(=O)c(CN(CCO)C(=S)Nc3ccccc3F)cc2c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: