Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetBeta-glucuronidase (EcGUS)
LigandBDBM163641
Substrate/Competitorn/a
Meas. Tech.Inhibition Assays
Ki 6.7e+2± 3e+1 nM
Citation Wallace BDRoberts ABPollet RMIngle JDBiernat KAPellock SJVenkatesh MKGuthrie LO'Neal SKRobinson SJDollinger MFigueroa EMcShane SRCohen RDJin JFrye SVZamboni WCPepe-Ranney CMani SKelly LRedinbo MR Structure and Inhibition of Microbiome -Glucuronidases Essential to the Alleviation of Cancer Drug Toxicity. Chem Biol 22:1238-49 (2015) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Beta-glucuronidase (EcGUS)
Name:Beta-glucuronidase (EcGUS)
Synonyms:β-Glucuronidase
Type:Protein
Mol. Mass.:68431.57
Organism:Escherichia coli (Enterobacteria)
Description:P05804
Residue:603
Sequence:
MLRPVETPTREIKKLDGLWAFSLDRENCGIDQRWWESALQESRAIAVPGSFNDQFADADI
RNYAGNVWYQREVFIPKGWAGQRIVLRFDAVTHYGKVWVNNQEVMEHQGGYTPFEADVTP
YVIAGKSVRITVCVNNELNWQTIPPGMVITDENGKKKQSYFHDFFNYAGIHRSVMLYTTP
NTWVDDITVVTHVAQDCNHASVDWQVVANGDVSVELRDADQQVVATGQGTSGTLQVVNPH
LWQPGEGYLYELCVTAKSQTECDIYPLRVGIRSVAVKGEQFLINHKPFYFTGFGRHEDAD
LRGKGFDNVLMVHDHALMDWIGANSYRTSHYPYAEEMLDWADEHGIVVIDETAAVGFNLS
LGIGFEAGNKPKELYSEEAVNGETQQAHLQAIKELIARDKNHPSVVMWSIANEPDTRPQG
AREYFAPLAEATRKLDPTRPITCVNVMFCDAHTDTISDLFDVLCLNRYYGWYVQSGDLET
AEKVLEKELLAWQEKLHQPIIITEYGVDTLAGLHSMYTDMWSEEYQCAWLDMYHRVFDRV
SAVVGEQVWNFADFATSQGILRVGGNKKGIFTRDRKPKSAAFLLQKRWTGMNFGEKPQQG
GKQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM163641
n/a
NameBDBM163641
Synonyms:1[2(3Fluorophenyl)5H,6H,7H,8Hpyrazolo[3,2b]quinazolin9yl]piperazine (Inh 6) | US9334288, 7
TypeSmall organic molecule
Emp. Form.C20H22FN5
Mol. Mass.351.4206
SMILESFc1cccc(c1)-c1cc2nc3CCCCc3c(N3CCNCC3)n2n1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: