Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetRhomboid protease (MmRHBDL3)
LigandBDBM50199883
Substrate/Competitorn/a
Meas. Tech.Activity-based Protein Profiling (ABPP)
pH7.4±0
Temperature310.15±0 K
IC50 7.0e+4± 1.3e+4 nM
Citation Wolf EVZeissler AVerhelst SH Inhibitor Fingerprinting of Rhomboid Proteases by Activity-Based Protein Profiling Reveals Inhibitor Selectivity and Rhomboid Autoprocessing. ACS Chem Biol 10:2325-33 (2015) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Rhomboid protease (MmRHBDL3)
Name:Rhomboid protease (MmRHBDL3)
Synonyms:Rhomboid-related protein 3
Type:Protein
Mol. Mass.:45272.26
Organism:Mus musculus (Mouse)
Description:n/a
Residue:404
Sequence:
MGEHPSPGPAVAACAEAERIEELEPEAEERLPAAPEDHWKVLFEKFDPGSTGYISTGKFR
SLLESHSSKLDPHKKEVLLALADSHADGQICYQDFVNLMSNKRSNSFRQAILQGNRRLSS
KALLEEKGLSLSQRLIRHVAYETLPREIDRKWYYDSYTCCPPPWFMITITLLEVALFLYN
GVLLDQFVLQVTHPRYLKNSLVYHPQLRAQAWRYVTYIFMHAGVEQLGLNVALQLLVGVP
LEMVHGATRIGLVYVAGVVAGSLAVSVADMTAPVVGSSGGVYALVSAHLANIVMNWSGMK
CQFKLLRMAVALICMSMEFGRAVWLRFHPSAYPPCPHPSFVAHLGGVAVGITLGVVVLRN
YEQRLQDQSLWWIFVTMYTIFVLFAVFWNIFAYTLLDLKLPPAP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50199883
n/a
NameBDBM50199883
Synonyms:3,4‐Dichloroisocoumarin (2) | 3,4-Dichloro-isochromen-1-one | 3,4-dichloro-1H-isochromen-1-one | 3,4-dichloroisocoumarin | CHEMBL24983 | cid_1609
TypeSmall organic molecule
Emp. Form.C9H4Cl2O2
Mol. Mass.215.033
SMILESClc1oc(=O)c2ccccc2c1Cl
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: