Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetTyrosine-protein kinase Lyn
LigandBDBM50430875
Substrate/Competitorn/a
Meas. Tech.Inhibition Assay
pH8±n/a
IC50 2.3±n/a nM
Commentsextracted
Citation Yang BKim YPark TWoo SLee HKim SCho JLee H Anti-inflammatory compound having inhibitory activity against multiple tyrosine kinases and pharmaceutical composition containing same US Patent  US9062066 Publication Date 6/23/2015
More Info.:Get all data from this article,  Assay Method
 
Tyrosine-protein kinase Lyn
Name:Tyrosine-protein kinase Lyn
Synonyms:JTK8 | LYN | Lck/Yes-related novel protein tyrosine kinase | Tyrosine-protein kinase Lyn (LYN) | V-yes-1 Yamaguchi sarcoma viral related oncogene homolog | p53Lyn | p56Lyn
Type:Protein
Mol. Mass.:58575.92
Organism:Homo sapiens (Human)
Description:P07948
Residue:512
Sequence:
MGCIKSKGKDSLSDDGVDLKTQPVRNTERTIYVRDPTSNKQQRPVPESQLLPGQRFQTKD
PEEQGDIVVALYPYDGIHPDDLSFKKGEKMKVLEEHGEWWKAKSLLTKKEGFIPSNYVAK
LNTLETEEWFFKDITRKDAERQLLAPGNSAGAFLIRESETLKGSFSLSVRDFDPVHGDVI
KHYKIRSLDNGGYYISPRITFPCISDMIKHYQKQADGLCRRLEKACISPKPQKPWDKDAW
EIPRESIKLVKRLGAGQFGEVWMGYYNNSTKVAVKTLKPGTMSVQAFLEEANLMKTLQHD
KLVRLYAVVTREEPIYIITEYMAKGSLLDFLKSDEGGKVLLPKLIDFSAQIAEGMAYIER
KNYIHRDLRAANVLVSESLMCKIADFGLARVIEDNEYTAREGAKFPIKWTAPEAINFGCF
TIKSDVWSFGILLYEIVTYGKIPYPGRTNADVMTALSQGYRMPRVENCPDELYDIMKMCW
KEKAEERPTFDYLQSVLDDFYTATEGQYQQQP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50430875
n/a
NameBDBM50430875
Synonyms:CHEMBL2336005 | US9062066, LCB 03-0110
TypeSmall organic molecule
Emp. Form.C24H23N3O2S
Mol. Mass.417.523
SMILESOc1cccc(Nc2ccnc3cc(sc23)-c2cccc(CN3CCOCC3)c2)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: