| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Renal Outer Medullary Potassium (ROMK) |
|---|
| Ligand | BDBM163764 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Electrophysiology Assay |
|---|
| pH | 7.4±n/a |
|---|
| IC50 | 90±n/a nM |
|---|
| Comments | extracted |
|---|
| Citation |  Pasternak A; Blizzard T; Chobanian H; de Jesus R; Ding F; Dong S; Gude C; Kim D; Tang H; Walsh S; Pio B; Jiang J Inhibitors of the renal outer medullary potassium channel US Patent US9062070 Publication Date 6/23/2015 |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Renal Outer Medullary Potassium (ROMK) |
|---|
| Name: | Renal Outer Medullary Potassium (ROMK) |
|---|
| Synonyms: | ATP-regulated potassium channel ROM-K | ATP-sensitive inward rectifier potassium channel 1 | Inward rectifier K(+) channel Kir1.1 | KAB-1 | Kcnj1 | Potassium channel (ATP modulatory) | Potassium channel, inwardly rectifying subfamily J member 1 | Renal Outer Medullary Potassium (ROMK1) | Romk1 | The Renal Outer Medullary Potassium (ROMK) channel (Kir1.1) |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 44976.27 |
|---|
| Organism: | Rattus norvegicus (Rat) |
|---|
| Description: | P35560 |
|---|
| Residue: | 391 |
|---|
| Sequence: | MGASERSVFRVLIRALTERMFKHLRRWFITHIFGRSRQRARLVSKEGRCNIEFGNVDAQS
RFIFFVDIWTTVLDLKWRYKMTVFITAFLGSWFLFGLLWYVVAYVHKDLPEFYPPDNRTP
CVENINGMTSAFLFSLETQVTIGYGFRFVTEQCATAIFLLIFQSILGVIINSFMCGAILA
KISRPKKRAKTITFSKNAVISKRGGKLCLLIRVANLRKSLLIGSHIYGKLLKTTITPEGE
TIILDQTNINFVVDAGNENLFFISPLTIYHIIDHNSPFFHMAAETLSQQDFELVVFLDGT
VESTSATCQVRTSYVPEEVLWGYRFVPIVSKTKEGKYRVDFHNFGKTVEVETPHCAMCLY
NEKDARARMKRGYDNPNFVLSEVDETDDTQM
|
|
|
|---|
| BDBM163764 |
|---|
| n/a |
|---|
| Name | BDBM163764 |
|---|
| Synonyms: | US9062070, 19 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C24H22F2N8O2 |
|---|
| Mol. Mass. | 492.4807 |
|---|
| SMILES | Fc1ccc([C@H]2CN3CCN(C[C@H]3CO2)C(=O)C2CCc3nc(ccc23)-n2cnnn2)c(F)c1[N+]#[C-] |r| |
|---|
| Structure | 
|
|---|
Search and Browse
