Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Target5-lipoxygenase/FLAP
LigandBDBM167191
Substrate/Competitorn/a
Meas. Tech.Homogeneous Time Resolved Fluorescence Assay
Ki 0.5±n/a nM
Citation Eccles WFitzgerald AEHack MDHawryluk NAJones WMKeith JMKrawczuk PLebsack ADLiu JMani NSMcClure KJMeduna SPRosen MD Flap modulators US Patent  US9073876 Publication Date 7/7/2015
More Info.:Get all data from this article,  Assay Method
 
5-lipoxygenase/FLAP
Name:5-lipoxygenase/FLAP
Synonyms:5-lipoxygenase activating protein | 5-lipoxygenase-activating protein (FLAP) | FLAP | MK-886-binding protein
Type:Enzyme
Mol. Mass.:18159.90
Organism:Homo sapiens (Human)
Description:P20292
Residue:161
Sequence:
MDQETVGNVVLLAIVTLISVVQNGFFAHKVEHESRTQNGRSFQRTGTLAFERVYTANQNC
VDAYPTFLAVLWSAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIIL
FLFLMSVAGIFNYYLIFFFGSDFENYIKTISTTISPLLLIP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM167191
n/a
NameBDBM167191
Synonyms:US9073876, 272 | US9732093, Compound 272
TypeSmall organic molecule
Emp. Form.C22H19FN6O
Mol. Mass.402.4243
SMILESNc1cnc(cn1)-c1ccc(C2CCC2)c(Oc2nc(N)c3ccccc3n2)c1F
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: