Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetATP-sensitive inward rectifier potassium channel 1
LigandBDBM167407
Substrate/Competitorn/a
Meas. Tech.Thallium Flux Assay
Temperature277.15±n/a K
IC50 12±n/a nM
Commentsextracted
Citation Tang HPasternak AYang LWalsh SPPio BShahripour ATeumelsan N Inhibitors of the renal outer medullary potassium channel US Patent  US9073882 Publication Date 7/7/2015
More Info.:Get all data from this article,  Assay Method
 
ATP-sensitive inward rectifier potassium channel 1
Name:ATP-sensitive inward rectifier potassium channel 1
Synonyms:Potassium channel (ATP modulatory) | Potassium inwardly-rectifying channel, subfamily J, member 1 | Renal Outer Medullary Potassium (ROMK1) | The Renal Outer Medullary Potassium (ROMK)
Type:Enzyme Catalytic Domain
Mol. Mass.:44809.08
Organism:Homo sapiens (Human)
Description:gi_223460826
Residue:391
Sequence:
MNASSRNVFDTLIRVLTESMFKHLRKWVVTRFFGHSRQRARLVSKDGRCNIEFGNVEAQS
RFIFFVDIWTTVLDLKWRYKMTIFITAFLGSWFFFGLLWYAVAYIHKDLPEFHPSANHTP
CVENINGLTSAFLFSLETQVTIGYGFRCVTEQCATAIFLLIFQSILGVIINSFMCGAILA
KISRPKKRAKTITFSKNAVISKRGGKLCLLIRVANLRKSLLIGSHIYGKLLKTTVTPEGE
TIILDQININFVVDAGNENLFFISPLTIYHVIDHNSPFFHMAAETLLQQDFELVVFLDGT
VESTSATCQVRTSYVPEEVLWGYRFAPIVSKTKEGKYRVDFHNFSKTVEVETPHCAMCLY
NEKDVRARMKRGYDNPNFILSEVNETDDTKM
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM167407
n/a
NameBDBM167407
Synonyms:US9073882, 94
TypeSmall organic molecule
Emp. Form.C27H32N2O4
Mol. Mass.448.554
SMILESCC(CN1CCN(CCc2ccc3C(=O)OCc3c2C)CC1)c1ccc2C(=O)OCc2c1C
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: