Reaction Details |
| Report a problem with these data |
Target | von Hippel-Lindau disease tumor suppressor |
---|
Ligand | BDBM171826 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | Inhibition Assay |
---|
pH | 7.5±n/a |
---|
IC50 | 1500±0 nM |
---|
Comments | extracted |
---|
Citation | Flamme, I; Ergüden, J; Oehme, F; Thede, K; Karig, G; Kuhl, A; Wild, H; Schuhmacher, J; Kolkhof, P; Bärfacker, L; Hütter, J 4-(pyridin-3-yl)-2(pyridin-2yl)-1,2-dihydro-3H-pyrazol-3-one derivatives as specific HIF-pyrolyl-4-hydroxylase inhibitors for treating cardiovascular and haematological diseases US Patent US9085572 Publication Date 7/21/2015 |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
von Hippel-Lindau disease tumor suppressor |
---|
Name: | von Hippel-Lindau disease tumor suppressor |
Synonyms: | Protein G7 | VHL | VHL_HUMAN | Von Hippel-Lindau disease tumor suppressor | Von Hippel-Lindau disease tumor suppressor protein (VBC) | pVHL |
Type: | Protein |
Mol. Mass.: | 24136.87 |
Organism: | Homo sapiens (Human) |
Description: | P40337 |
Residue: | 213 |
Sequence: | MPRRAENWDEAEVGAEEAGVEEYGPEEDGGEESGAEESGPEESGPEELGAEEEMEAGRPR
PVLRSVNSREPSQVIFCNRSPRVVLPVWLNFDGEPQPYPTLPPGTGRRIHSYRGHLWLFR
DAGTHDGLLVNQTELFVPSLNVDGQPIFANITLPVYTLKERCLQVVRSLVKPENYRRLDI
VRSLYEDLEDHPNVQKDLERLTQERIAHQRMGD
|
|
|
BDBM171826 |
---|
n/a |
---|
Name | BDBM171826 |
Synonyms: | US9085572, 43 |
Type | n/a |
Emp. Form. | C14H12N4O2 |
Mol. Mass. | 268.2707 |
SMILES | OCc1ccnc(c1)-n1[nH]cc(-c2cccnc2)c1=O |
Structure |
|