Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Targetα-glucosidase
LigandBDBM173530
Substrate/Competitorn/a
Meas. Tech.α-Glucosidase Inhibitory Activity
IC50 2.3e+3± 1.1e+2 nM
Citation Taha MIsmail NHJavaid KImran SAnouar el HWadood AAtia-Tul-Wahab nullAli MKhan KMSaad SMRahim FChoudhary MI Evaluation of 2-indolcarbohydrazones as potent a-glucosidase inhibitors, in silico studies and DFT based stereochemical predictions. Bioorg Chem 63:24-35 (2015) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
α-glucosidase
Name:α-glucosidase
Synonyms:Alpha-glucosidase | Alpha-glucosidase (α-glucosidase) | Oligo-1,6-glucosidase
Type:Protein
Mol. Mass.:68577.59
Organism:Saccharomyces cerevisiae S288c (Baker's yeast)
Description:n/a
Residue:589
Sequence:
MTISSAHPETEPKWWKEATFYQIYPASFKDSNDDGWGDMKGIASKLEYIKELGADAIWIS
PFYDSPQDDMGYDIANYEKVWPTYGTNEDCFALIEKTHKLGMKFITDLVINHCSSEHEWF
KESRSSKTNPKRDWFFWRPPKGYDAEGKPIPPNNWKSYFGGSAWTFDEKTQEFYLRLFCS
TQPDLNWENEDCRKAIYESAVGYWLDHGVDGFRIDVGSLYSKVVGLPDAPVVDKNSTWQS
SDPYTLNGPRIHEFHQEMNQFIRNRVKDGREIMTVGEMQHASDETKRLYTSASRHELSEL
FNFSHTDVGTSPLFRYNLVPFELKDWKIALAELFRYINGTDCWSTIYLENHDQPRSITRF
GDDSPKNRVISGKLLSVLLSALTGTLYVYQGQELGQINFKNWPVEKYEDVEIRNNYNAIK
EEHGENSEEMKKFLEAIALISRDHARTPMQWSREEPNAGFSGPSAKPWFYLNDSFREGIN
VEDEIKDPNSVLNFWKEALKFRKAHKDITVYGYDFEFIDLDNKKLFSFTKKYNNKTLFAA
LNFSSDATDFKIPNDDSSFKLEFGNYPKKEVDASSRTLKPWEGRIYISE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM173530
n/a
NameBDBM173530
Synonyms:(E)-N'-(3,4,5-trihydroxybenzylidene)-1H-indole-2-carbohydrazide (1)
TypeSmall organic molecule
Emp. Form.C16H13N3O4
Mol. Mass.311.2921
SMILESOc1cc(\C=N\NC(=O)c2cc3ccccc3[nH]2)cc(O)c1O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: