| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Ribonuclease pancreatic |
|---|
| Ligand | BDBM173611 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Ribonuclease Activity Assay |
|---|
| Temperature | 303.15±n/a K |
|---|
| Ki | 1.504e+5± 2.27e+4 nM |
|---|
| Comments | extracted |
|---|
| Citation |  Chatzileontiadou, DS; Parmenopoulou, V; Manta, S; Kantsadi, AL; Kylindri, P; Griniezaki, M; Kontopoulou, F; Telopoulou, A; Prokova, H; Panagopoulos, D; Boix, E; Balatsos, NA; Komiotis, D; Leonidas, DD Triazole double-headed ribonucleosides as inhibitors of eosinophil derived neurotoxin. Bioorg Chem63:152-65 (2015) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Ribonuclease pancreatic |
|---|
| Name: | Ribonuclease pancreatic |
|---|
| Synonyms: | CAM-RNase A | RNAS1_BOVIN | RNASE1 | RNAse A | RNS1 |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 16468.79 |
|---|
| Organism: | Bison bison (American bison) |
|---|
| Description: | carboxamidomethylated RNase A |
|---|
| Residue: | 150 |
|---|
| Sequence: | MALKSLVLLSLLVLVLLLVRVQPSLGKETAAAKFERQHMDSSTSAASSSNYCNQMMKSRN
LTKDRCKPVNTFVHESLADVQAVCSQKNVACKNGQTNCYQSYSTMSITDCRETGSSKYPN
CAYKTTQANKHIIVACEGNPYVPVHFDASV
|
|
|
|---|
| BDBM173611 |
|---|
| n/a |
|---|
| Name | BDBM173611 |
|---|
| Synonyms: | 9-[3'-[4-[(Thymine-1-yl)methyl]-1,2,3-triazol-1-yl]-b-D-ribofuranosyl]N6-benzoyladenine (11b) |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C25H24N10O6 |
|---|
| Mol. Mass. | 560.5215 |
|---|
| SMILES | Cc1cn(Cc2cn(nn2)[C@H]2[C@@H](CO)O[C@H](C2O)n2cnc3c(NC(=O)c4ccccc4)ncnc23)c(=O)[nH]c1=O |r| |
|---|
| Structure | 
|
|---|
Search and Browse
