Reaction Details |
| Report a problem with these data |
Target | Protein Nef |
---|
Ligand | BDBM288029 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | Measurement of Antiviral (HIV-1) Activity |
---|
Temperature | 298.15±n/a K |
---|
EC50 | 3.60±n/a nM |
---|
Comments | extracted |
---|
Citation | Miyazaki, S; Isoshima, H; Oshita, K; Kawashita, S; Nagahashi, N; Terashita, M Substituted spiropyrido[1,2-a]pyrazine derivative and medicinal use thereof as HIV integrase inhibitor US Patent US10087178 Publication Date 10/2/2018 |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Protein Nef |
---|
Name: | Protein Nef |
Synonyms: | 3ORF | F-protein | HIV-1 Nef | NEF_HV1BR | Negative factor | Protein Nef | nef |
Type: | C-terminal core protein |
Mol. Mass.: | 23340.47 |
Organism: | Human immunodeficiency virus type 1 (isolate BRU/LAI group M subtype B) |
Description: | P03406 |
Residue: | 206 |
Sequence: | MGGKWSKSSVVGWPTVRERMRRAEPAADGVGAASRDLEKHGAITSSNTAATNAACAWLEA
QEEEEVGFPVTPQVPLRPMTYKAAVDLSHFLKEKGGLEGLIHSQRRQDILDLWIYHTQGY
FPDWQNYTPGPGVRYPLTFGWCYKLVPVEPDKVEEANKGENTSLLHPVSLHGMDDPEREV
LEWRFDSRLAFHHVARELHPEYFKNC
|
|
|
BDBM288029 |
---|
n/a |
---|
Name | BDBM288029 |
Synonyms: | US10087178, Example 10 |
Type | Small organic molecule |
Emp. Form. | C23H25F2N3O5 |
Mol. Mass. | 461.4585 |
SMILES | COC[C@H]1C[C@@]11CN(C(C)C)C(=O)c2c(O)c(=O)c(cn12)C(=O)NCc1ccc(F)cc1F |r| |
Structure |
|