Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCannabinoid receptor 2
LigandBDBM176620
Substrate/Competitorn/a
Meas. Tech.Binding Assay
IC50 2.7±n/a nM
Citation Arnaud JArtiaga MBarth FHortala LMartinez SRoux P 1,3,5-triazine-2-amine derivatives, preparation thereof and diagnostic and therapeutic use thereof US Patent  US9115121 Publication Date 8/25/2015
More Info.:Get all data from this article,  Assay Method
 
Cannabinoid receptor 2
Name:Cannabinoid receptor 2
Synonyms:CANNABINOID CB2 | CB-2 | CB2 | CB2A | CB2B | CNR2 | CX5 | Cannabinoid CB2 receptor | Cannabinoid receptor 2 (CB2) | Cannabinoid receptor 2 (CB2R) | hCB2
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:39690.94
Organism:Homo sapiens (Human)
Description:P34972
Residue:360
Sequence:
MEECWVTEIANGSKDGLDSNPMKDYMILSGPQKTAVAVLCTLLGLLSALENVAVLYLILS
SHQLRRKPSYLFIGSLAGADFLASVVFACSFVNFHVFHGVDSKAVFLLKIGSVTMTFTAS
VGSLLLTAIDRYLCLRYPPSYKALLTRGRALVTLGIMWVLSALVSYLPLMGWTCCPRPCS
ELFPLIPNDYLLSWLLFIAFLFSGIIYTYGHVLWKAHQHVASLSGHQDRQVPGMARMRLD
VRLAKTLGLVLAVLLICWFPVLALMAHSLATTLSDQVKKAFAFCSMLCLINSMVNPVIYA
LRSGEIRSSAHHCLAHWKKCVRGLGSEAKEEAPRSSVTETEADGKITPWPDSRDLDLSDC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM176620
n/a
NameBDBM176620
Synonyms:US9115121, 11
TypeSmall organic molecule
Emp. Form.C21H22FN5O3S
Mol. Mass.443.494
SMILESCOc1nc(NCCc2ccc(F)cc2)nc(n1)-c1cccc(c1)S(=O)(=O)NC1CC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: