| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Apoptosis regulator Bcl-2 |
|---|
| Ligand | BDBM177872 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Fluorescence Polarisation Assay |
|---|
| pH | 7.4±n/a |
|---|
| IC50 | 12±n/a nM |
|---|
| Comments | extracted |
|---|
| Citation |  Le Diguarher, T; Casara, P; Starck, J; Henlin, J; Davidson, JE; Murray, JB; Graham, CJ; Chen, I; Geneste, O; Hickman, J; Depil, S; Le Tiran, A; Nyerges, M; De Nanteuil, G Indolizine compounds, a process for their preparation and pharmaceutical compositions containing them US Patent US9120791 Publication Date 9/1/2015 |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Apoptosis regulator Bcl-2 |
|---|
| Name: | Apoptosis regulator Bcl-2 |
|---|
| Synonyms: | BCL2_MOUSE | Bcl-2 | Bcl2 |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 26409.44 |
|---|
| Organism: | Mus musculus (Mouse) |
|---|
| Description: | P10417 |
|---|
| Residue: | 236 |
|---|
| Sequence: | MAQAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDADAAPLGAAPTPGIFSFQPESNPMPA
VHRDMAARTSPLRPLVATAGPALSPVPPVVHLTLRRAGDDFSRRYRRDFAEMSSQLHLTP
FTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNR
HLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK
|
|
|
|---|
| BDBM177872 |
|---|
| n/a |
|---|
| Name | BDBM177872 |
|---|
| Synonyms: | US9120791, Example 98 | US9603854, 98 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C42H40F2N4O5 |
|---|
| Mol. Mass. | 718.7876 |
|---|
| SMILES | Cc1ccc(cc1F)N(C(=O)c1cc(-c2cc(F)ccc2C(=O)N2Cc3ccccc3C[C@H]2CN2CCOCC2)n2CCOCc12)c1ccc(O)cc1 |
|---|
| Structure | 
|
|---|
Search and Browse
