Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPurinergic receptor P2Y1
LigandBDBM50015289
Substrate/Competitorn/a
Meas. Tech.Scintillation Proximity Assay (SPA) Assay
pH7.4±n/a
Temperature298.15±n/a K
IC50 8±n/a nM
Commentsextracted
Citation Qiao JXHu CHThibeault C Amino-heteroaryl 7-hydroxy-spiropiperidine indolinyl antagonists of P2Y1 receptor US Patent  US9120798 Publication Date 9/1/2015
More Info.:Get all data from this article,  Assay Method
 
Purinergic receptor P2Y1
Name:Purinergic receptor P2Y1
Synonyms:ATP receptor | P2Y purinoceptor 1 (P2Y1) | P2Y1 | Purinergic receptor
Type:Enzyme
Mol. Mass.:42090.25
Organism:Homo sapiens (Human)
Description:P47900
Residue:373
Sequence:
MTEVLWPAVPNGTDAAFLAGPGSSWGNSTVASTAAVSSSFKCALTKTGFQFYYLPAVYIL
VFIIGFLGNSVAIWMFVFHMKPWSGISVYMFNLALADFLYVLTLPALIFYYFNKTDWIFG
DAMCKLQRFIFHVNLYGSILFLTCISAHRYSGVVYPLKSLGRLKKKNAICISVLVWLIVV
VAISPILFYSGTGVRKNKTITCYDTTSDEYLRSYFIYSMCTTVAMFCVPLVLILGCYGLI
VRALIYKDLDNSPLRRKSIYLVIIVLTVFAVSYIPFHVMKTMNLRARLDFQTPAMCAFND
RVYATYQVTRGLASLNSCVDPILYFLAGDTFRRRLSRATRKASRRSEANLQSKSEDMTLN
ILPEFKQNGDTSL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50015289
n/a
NameBDBM50015289
Synonyms:CHEMBL3263069 | US9120798, 44
TypeSmall organic molecule
Emp. Form.C37H45N5O3S
Mol. Mass.639.85
SMILESCOC(=O)c1ccc(O)c2N(CC3(CCN(CC(C)(C)C)CC3)c12)c1ccccc1Nc1nnc(s1)-c1ccc(cc1)C(C)(C)C
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: