Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHistone deacetylase 1
LigandBDBM178095
Substrate/Competitorn/a
Meas. Tech.In-vitro HDAC Enzymatic Endpoint Assay
pH7.4±n/a
Temperature298.15±n/a K
Ki 3± 0 nM
IC50 2± 1 nM
Commentsextracted
Citation Wagner FFLundh MKaya TMcCarren PZhang YLChattopadhyay SGale JPGalbo TFisher SLMeier BCVetere ARichardson SMorgan NGChristensen DPGilbert TJHooker JMLeroy MWalpita DMandrup-Poulsen TWagner BKHolson EB An Isochemogenic Set of Inhibitors To Define the Therapeutic Potential of Histone Deacetylases in -Cell Protection. ACS Chem Biol 11:363-74 (2016) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Histone deacetylase 1
Name:Histone deacetylase 1/6
Synonyms:HD1 | Histone deacetylase 1 (HDAC1) | Human HDAC1 | RPD3L1
Type:Enzyme
Mol. Mass.:55090.27
Organism:Homo sapiens (Human)
Description:Purified from NIH 3T3 cells harboring human HDAC1 using an anti-FLAG M2 antibody.
Residue:482
Sequence:
MAQTQGTRRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKAN
AEEMTKYHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVAS
AVKLNKQQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHG
DGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNYPLRDGIDDESYEAI
FKPVMSKVMEMFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGG
GGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLE
KIKQRLFENLRMLPHAPGVQMQAIPEDAIPEESGDEDEDDPDKRISICSSDKRIACEEEF
SDSEEEGEGGRKNSSNFKKAKRVKTEDEKEKDPEEKKEVTEEEKTKEEKPEAKGVKEEVK
LA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM178095
n/a
NameBDBM178095
Synonyms:BRD2492
TypeSmall organic molecule
Emp. Form.C20H18N4O2
Mol. Mass.346.3825
SMILESCC(=O)Nc1ccc(cc1)C(=O)Nc1cc(ccc1N)-c1ccncc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: