Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHistone deacetylase 3
LigandBDBM178095
Substrate/Competitorn/a
Meas. Tech.In-vitro HDAC Enzymatic Endpoint Assay
pH7.4±n/a
Temperature298.15±n/a K
Ki 1.4e+4± 0 nM
IC50 2.08e+3± 679 nM
Commentsextracted
Citation Wagner FFLundh MKaya TMcCarren PZhang YLChattopadhyay SGale JPGalbo TFisher SLMeier BCVetere ARichardson SMorgan NGChristensen DPGilbert TJHooker JMLeroy MWalpita DMandrup-Poulsen TWagner BKHolson EB An Isochemogenic Set of Inhibitors To Define the Therapeutic Potential of Histone Deacetylases in -Cell Protection. ACS Chem Biol 11:363-74 (2016) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Histone deacetylase 3
Name:Histone deacetylase 1/2/3
Synonyms:HD3 | Histone deacetylase 3 (HDAC3) | Human HDAC3 | RPD3-2 | SMAP45
Type:Enzyme
Mol. Mass.:48829.55
Organism:Homo sapiens (Human)
Description:n/a
Residue:428
Sequence:
MAKTVAYFYDPDVGNFHYGAGHPMKPHRLALTHSLVLHYGLYKKMIVFKPYQASQHDMCR
FHSEDYIDFLQRVSPTNMQGFTKSLNAFNVGDDCPVFPGLFEFCSRYTGASLQGATQLNN
KICDIAINWAGGLHHAKKFEASGFCYVNDIVIGILELLKYHPRVLYIDIDIHHGDGVQEA
FYLTDRVMTVSFHKYGNYFFPGTGDMYEVGAESGRYYCLNVPLRDGIDDQSYKHLFQPVI
NQVVDFYQPTCIVLQCGADSLGCDRLGCFNLSIRGHGECVEYVKSFNIPLLVLGGGGYTV
RNVARCWTYETSLLVEEAISEELPYSEYFEYFAPDFTLHPDVSTRIENQNSRQYLDQIRQ
TIFENLKMLNHAPSVQIHDVPADLLTYDRTDEADAEERGPEENYSRPEAPNEFYDGDHDN
DKESDVEI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM178095
n/a
NameBDBM178095
Synonyms:BRD2492
TypeSmall organic molecule
Emp. Form.C20H18N4O2
Mol. Mass.346.3825
SMILESCC(=O)Nc1ccc(cc1)C(=O)Nc1cc(ccc1N)-c1ccncc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: