Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHistone deacetylase 2
LigandBDBM178096
Substrate/Competitorn/a
Meas. Tech.In-vitro HDAC Enzymatic Endpoint Assay
pH7.4±n/a
Temperature298.15±n/a K
IC50 1.776e+4± 8.62e+3 nM
Commentsextracted
Citation Wagner FFLundh MKaya TMcCarren PZhang YLChattopadhyay SGale JPGalbo TFisher SLMeier BCVetere ARichardson SMorgan NGChristensen DPGilbert TJHooker JMLeroy MWalpita DMandrup-Poulsen TWagner BKHolson EB An Isochemogenic Set of Inhibitors To Define the Therapeutic Potential of Histone Deacetylases in -Cell Protection. ACS Chem Biol 11:363-74 (2016) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Histone deacetylase 2
Name:Histone deacetylase 2
Synonyms:HD2 | HDAC2 | Histone deacetylase 2 (HDAC2) | Human HDAC2
Type:Chromatin regulator; hydrolase; repressor
Mol. Mass.:55356.54
Organism:Homo sapiens (Human)
Description:The assay was performed using isolated HDAC2 that had been expressed as full-length 6x His-tagged fusion proteins in a baculovirus expression system in Sf9 cells.
Residue:488
Sequence:
MAYSQGGGKKKVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKA
TAEEMTKYHSDEYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVA
GAVKLNRQQTDMAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHH
GDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNFPMRDGIDDESYGQ
IFKPIISKVMEMYQPSAVVLQCGADSLSGDRLGCFNLTVKGHAKCVEVVKTFNLPLLMLG
GGGYTIRNVARCWTYETAVALDCEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTPEYM
EKIKQRLFENLRMLPHAPGVQMQAIPEDAVHEDSGDEDGEDPDKRISIRASDKRIACDEE
FSDSEDEGEGGRRNVADHKKGAKKARIEEDKKETEDKKTDVKEEDKSKDNSGEKTDTKGT
KSEQLSNP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM178096
n/a
NameBDBM178096
Synonyms:4-Acetamido-N-(2-amino-5-methylphenyl)benzamide (6)
TypeSmall organic molecule
Emp. Form.C16H17N3O2
Mol. Mass.283.3251
SMILESCC(=O)Nc1ccc(cc1)C(=O)Nc1cc(C)ccc1N
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: