Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHistone deacetylase 6
LigandBDBM19422
Substrate/Competitorn/a
Meas. Tech.In-vitro HDAC Enzymatic Endpoint Assay
pH7.4±n/a
Temperature298.15±n/a K
IC50>3.33e+4± 0 nM
Commentsextracted
Citation Wagner FFLundh MKaya TMcCarren PZhang YLChattopadhyay SGale JPGalbo TFisher SLMeier BCVetere ARichardson SMorgan NGChristensen DPGilbert TJHooker JMLeroy MWalpita DMandrup-Poulsen TWagner BKHolson EB An Isochemogenic Set of Inhibitors To Define the Therapeutic Potential of Histone Deacetylases in -Cell Protection. ACS Chem Biol 11:363-74 (2016) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Histone deacetylase 6
Name:Histone deacetylase 1/6
Synonyms:HD6 | Histone deacetylase 6 (HDAC6) | Human HDAC6 | KIAA0901 | ORF Names:JM21
Type:Chromatin regulator; hydrolase; repressor
Mol. Mass.:131381.51
Organism:Homo sapiens (Human)
Description:The assay was performed using isolated HDAC6 that had been expressed as full-length 6x His-tagged fusion proteins in a baculovirus expression system in Sf9 cells.
Residue:1215
Sequence:
MTSTGQDSTTTRQRRSRQNPQSPPQDSSVTSKRNIKKGAVPRSIPNLAEVKKKGKMKKLG
QAMEEDLIVGLQGMDLNLEAEALAGTGLVLDEQLNEFHCLWDDSFPEGPERLHAIKEQLI
QEGLLDRCVSFQARFAEKEELMLVHSLEYIDLMETTQYMNEGELRVLADTYDSVYLHPNS
YSCACLASGSVLRLVDAVLGAEIRNGMAIIRPPGHHAQHSLMDGYCMFNHVAVAARYAQQ
KHRIRRVLIVDWDVHHGQGTQFTFDQDPSVLYFSIHRYEQGRFWPHLKASNWSTTGFGQG
QGYTINVPWNQVGMRDADYIAAFLHVLLPVALEFQPQLVLVAAGFDALQGDPKGEMAATP
AGFAQLTHLLMGLAGGKLILSLEGGYNLRALAEGVSASLHTLLGDPCPMLESPGAPCRSA
QASVSCALEALEPFWEVLVRSTETVERDNMEEDNVEESEEEGPWEPPVLPILTWPVLQSR
TGLVYDQNMMNHCNLWDSHHPEVPQRILRIMCRLEELGLAGRCLTLTPRPATEAELLTCH
SAEYVGHLRATEKMKTRELHRESSNFDSIYICPSTFACAQLATGAACRLVEAVLSGEVLN
GAAVVRPPGHHAEQDAACGFCFFNSVAVAARHAQTISGHALRILIVDWDVHHGNGTQHMF
EDDPSVLYVSLHRYDHGTFFPMGDEGASSQIGRAAGTGFTVNVAWNGPRMGDADYLAAWH
RLVLPIAYEFNPELVLVSAGFDAARGDPLGGCQVSPEGYAHLTHLLMGLASGRIILILEG
GYNLTSISESMAACTRSLLGDPPPLLTLPRPPLSGALASITETIQVHRRYWRSLRVMKVE
DREGPSSSKLVTKKAPQPAKPRLAERMTTREKKVLEAGMGKVTSASFGEESTPGQTNSET
AVVALTQDQPSEAATGGATLAQTISEAAIGGAMLGQTTSEEAVGGATPDQTTSEETVGGA
ILDQTTSEDAVGGATLGQTTSEEAVGGATLAQTTSEAAMEGATLDQTTSEEAPGGTELIQ
TPLASSTDHQTPPTSPVQGTTPQISPSTLIGSLRTLELGSESQGASESQAPGEENLLGEA
AGGQDMADSMLMQGSRGLTDQAIFYAVTPLPWCPHLVAVCPIPAAGLDVTQPCGDCGTIQ
ENWVCLSCYQVYCGRYINGHMLQHHGNSGHPLVLSYIDLSAWCYYCQAYVHHQALLDVKN
IAHQNKFGEDMPHPH
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM19422
n/a
NameBDBM19422
Synonyms:4-(acetylamino)-N-(2-amino-phenyl) benzamide | CI-994 | N-(2-aminophenyl)-4-acetamidobenzamide | N-acetyldinaline
TypeSmall organic molecule
Emp. Form.C15H15N3O2
Mol. Mass.269.2985
SMILESCC(=O)Nc1ccc(cc1)C(=O)Nc1ccccc1N
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: