Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetProtein arginine methyltransferase 3 (PRMT3)
LigandBDBM178101
Substrate/Competitorn/a
Meas. Tech.PRMT Biochemical Assays
Ki>50000±0.0 nM
IC50>100000±0.0 nM
Citation Eram MSShen YSzewczyk MMWu HSenisterra GLi FButler KVKaniskan HÿSpeed BADela Sea CDong AZeng HSchapira MBrown PJArrowsmith CHBarsyte-Lovejoy DLiu JVedadi MJin J A Potent, Selective, and Cell-Active Inhibitor of Human Type I Protein Arginine Methyltransferases. ACS Chem Biol 11:772-81 (2016) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Protein arginine methyltransferase 3 (PRMT3)
Name:Protein arginine N-methyltransferase 3
Synonyms:Heterogeneous nuclear ribonucleoprotein methyltransferase-like protein 3 | Protein arginine N-methyltransferase 3 | Protein arginine N-methyltransferase 3 (PRMT3)
Type:Protein
Mol. Mass.:59859.85
Organism:Homo sapiens (Human)
Description:n/a
Residue:531
Sequence:
MCSLASGATGGRGAVENEEDLPELSDSGDEAAWEDEDDADLPHGKQQTPCLFCNRLFTSA
EETFSHCKSEHQFNIDSMVHKHGLEFYGYIKLINFIRLKNPTVEYMNSIYNPVPWEKEEY
LKPVLEDDLLLQFDVEDLYEPVSVPFSYPNGLSENTSVVEKLKHMEARALSAEAALARAR
EDLQKMKQFAQDFVMHTDVRTCSSSTSVIADLQEDEDGVYFSSYGHYGIHEEMLKDKIRT
ESYRDFIYQNPHIFKDKVVLDVGCGTGILSMFAAKAGAKKVLGVDQSEILYQAMDIIRLN
KLEDTITLIKGKIEEVHLPVEKVDVIISEWMGYFLLFESMLDSVLYAKNKYLAKGGSVYP
DICTISLVAVSDVNKHADRIAFWDDVYGFKMSCMKKAVIPEAVVEVLDPKTLISEPCGIK
HIDCHTTSISDLEFSSDFTLKITRTSMCTAIAGYFDIYFEKNCHNRVVFSTGPQSTKTHW
KQTVFLLEKPFSVKAGEALKGKVTVHKSKKDPRSLTVTLTLNNSTQTYGLQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM178101
n/a
NameBDBM178101
Synonyms:N1-Methyl-N1-((5-(3-(trifluoromethyl)phenyl)-2H-1,2,3-triazol-4-yl)methyl)ethane-1,2-diamine (Compound 1)
TypeSmall organic molecule
Emp. Form.C13H16F3N5
Mol. Mass.299.2948
SMILESCN(CCN)Cc1n[nH]nc1-c1cccc(c1)C(F)(F)F
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: