Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetProtein-arginine N-methyltransferase 1
LigandBDBM178102
Substrate/Competitorn/a
Meas. Tech.PRMT Biochemical Assays
Ki 120±4 nM
IC50 250±15 nM
Citation Eram MSShen YSzewczyk MMWu HSenisterra GLi FButler KVKaniskan HÿSpeed BADela Sea CDong AZeng HSchapira MBrown PJArrowsmith CHBarsyte-Lovejoy DLiu JVedadi MJin J A Potent, Selective, and Cell-Active Inhibitor of Human Type I Protein Arginine Methyltransferases. ACS Chem Biol 11:772-81 (2016) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Protein-arginine N-methyltransferase 1
Name:Protein-arginine N-methyltransferase 1
Synonyms:Protein arginine N-methyltransferase 1 (PRMT1) | Protein arginine methyltransferase 1 (PRMT1)
Type:Protein
Mol. Mass.:41506.52
Organism:Homo sapiens (Human)
Description:n/a
Residue:361
Sequence:
MENFVATLANGMSLQPPLEEVSCGQAESSEKPNAEDMTSKDYYFDSYAHFGIHEEMLKDE
VRTLTYRNSMFHNRHLFKDKVVLDVGSGTGILCMFAAKAGARKVIGIECSSISDYAVKIV
KANKLDHVVTIIKGKVEEVELPVEKVDIIISEWMGYCLFYESMLNTVLYARDKWLAPDGL
IFPDRATLYVTAIEDRQYKDYKIHWWENVYGFDMSCIKDVAIKEPLVDVVDPKQLVTNAC
LIKEVDIYTVKVEDLTFTSPFCLQVKRNDYVHALVAYFNIEFTRCHKRTGFSTSPESPYT
HWKQTVFYMEDYLTVKTGEEIFGTIGMRPNAKNNRDLDFTIDLDFKGQLCELSCSTDYRM
R
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM178102
n/a
NameBDBM178102
Synonyms:N1-Methyl-N1-((4-(3-(trifluoromethyl)phenyl)-1H-pyrrol-3-yl)methyl)ethane-1,2-diamine (Compound 2)
TypeSmall organic molecule
Emp. Form.C15H18F3N3
Mol. Mass.297.3187
SMILESCN(CCN)Cc1c[nH]cc1-c1cccc(c1)C(F)(F)F
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: