Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetProtein arginine N-methyltransferase 6
LigandBDBM178102
Substrate/Competitorn/a
Meas. Tech.PRMT Biochemical Assays
Ki 3±0.3 nM
IC50 9±0.9 nM
Citation Eram MSShen YSzewczyk MMWu HSenisterra GLi FButler KVKaniskan HÿSpeed BADela Sea CDong AZeng HSchapira MBrown PJArrowsmith CHBarsyte-Lovejoy DLiu JVedadi MJin J A Potent, Selective, and Cell-Active Inhibitor of Human Type I Protein Arginine Methyltransferases. ACS Chem Biol 11:772-81 (2016) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Protein arginine N-methyltransferase 6
Name:Protein arginine N-methyltransferase 6
Synonyms:Heterogeneous nuclear ribonucleoprotein methyltransferase-like protein 6 | Histone-arginine N-methyltransferase PRMT6 | Protein arginine methyltransferase 6 (PRMT6)
Type:Protein
Mol. Mass.:41928.48
Organism:Homo sapiens (Human)
Description:n/a
Residue:375
Sequence:
MSQPKKRKLESGGGGEGGEGTEEEDGAEREAALERPRRTKRERDQLYYECYSDVSVHEEM
IADRVRTDAYRLGILRNWAALRGKTVLDVGAGTGILSIFCAQAGARRVYAVEASAIWQQA
REVVRFNGLEDRVHVLPGPVETVELPEQVDAIVSEWMGYGLLHESMLSSVLHARTKWLKE
GGLLLPASAELFIAPISDQMLEWRLGFWSQVKQHYGVDMSCLEGFATRCLMGHSEIVVQG
LSGEDVLARPQRFAQLELSRAGLEQELEAGVGGRFRCSCYGSAPMHGFAIWFQVTFPGGE
SEKPLVLSTSPFHPATHWKQALLYLNEPVQVEQDTDVSGEITLLPSRDNPRRLRVLLRYK
VGDQEEKTKDFAMED
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM178102
n/a
NameBDBM178102
Synonyms:N1-Methyl-N1-((4-(3-(trifluoromethyl)phenyl)-1H-pyrrol-3-yl)methyl)ethane-1,2-diamine (Compound 2)
TypeSmall organic molecule
Emp. Form.C15H18F3N3
Mol. Mass.297.3187
SMILESCN(CCN)Cc1c[nH]cc1-c1cccc(c1)C(F)(F)F
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: